SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26840

Feature Type:gene_model
Chromosome:Gm03
Start:34366497
stop:34367311
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G60450AT Annotation by Michelle Graham. TAIR10: Phosphoglycerate mutase family protein | chr3:22340982-22342187 FORWARD LENGTH=274 SoyBaseE_val: 1.00E-49ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
PTHR16469Panther FAMILY NOT NAMED JGI ISS
PTHR16469:SF13Panther UNKNOWN PROTEIN JGI ISS
UniRef100_I1KJM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJM9_SOYBN SoyBaseE_val: 7.00E-96ISS
UniRef100_O82047UniRef Annotation by Michelle Graham. Most informative UniRef hit: PRIB5 protein (Fragment) n=1 Tax=Ribes nigrum RepID=O82047_RIBNI SoyBaseE_val: 5.00E-48ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26840 not represented in the dataset

Glyma03g26840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g14490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g115500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g26840.1   sequence type=CDS   gene model=Glyma03g26840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCTGTTATGTGAAATGATGAGCAGGAACGCGATCAGACTTGAGGTGGCTCCTAAGGATGGAAATTGGGGCTTCAATATATCGGAGCGTAAGGCCATGCTTCTGGCAGGGACAGTGGATAAGAATGTGGAAAGGGTCTATAAAGAGTTGCCCAAGTGGGAAGAAGATCCCAATTTGCACACAAGGCCAAGATATAAGCAAATTGTTAAGGACCTTGCAGACAAATATCATACTGAGAACTTGCTGCTTGTCACACACGGGGAAGGTGTTGGGGTGGCTCTTTCTTCATTCAAAAAGGATGTTGAAGTGTACGAAGTTGATTACTGTGGATATGTCCAACTTAGACGCCCAATTTTCAAGAAAGACCAGTCTTTTACTGCAGGAGAATTTGAAGTTCTTACTCACAATGGTCAAACCGGCATAAATTTCATGTCAAATAAGGCCTGA

>Glyma03g26840.1   sequence type=predicted peptide   gene model=Glyma03g26840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FLLCEMMSRNAIRLEVAPKDGNWGFNISERKAMLLAGTVDKNVERVYKELPKWEEDPNLHTRPRYKQIVKDLADKYHTENLLLVTHGEGVGVALSSFKKDVEVYEVDYCGYVQLRRPIFKKDQSFTAGEFEVLTHNGQTGINFMSNKA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo