SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26740): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26740

Feature Type:gene_model
Chromosome:Gm03
Start:34223129
stop:34225428
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G05180AT Annotation by Michelle Graham. TAIR10: photosystem II subunit Q-2 | chr4:2672093-2673170 REVERSE LENGTH=230 SoyBaseE_val: 8.00E-107ISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0018119GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0019898GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extrinsic to membrane SoyBaseN/AISS
GO:0030095GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
PF05757PFAM Oxygen evolving enhancer protein 3 (PsbQ) JGI ISS
UniRef100_C6SWP9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWP9_SOYBN SoyBaseE_val: 2.00E-164ISS
UniRef100_Q41932UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxygen-evolving enhancer protein 3-2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=PSBQ2_ARATH SoyBaseE_val: 4.00E-104ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26740 not represented in the dataset

Glyma03g26740 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g14340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g114600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g26740.1   sequence type=CDS   gene model=Glyma03g26740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAAGCAATGGCATCAATGACTAGCTTACGTGGTTCCTCTCAGGCTGTGTTGGAAGGTAGCCTTGGCTCCACACGCTTGAATGTGGGGAGTGGAAGCAGGGTGGCCTCAGTCACACGTGCAGGGTTCACAGTTAGAGCACAGCAACAACAAGTGAATGGTGGTGAGGTACAAAGTAGCCGTAGGGCAGTGCTTTCACTTGTTGCTGCTGGTTTGACCACTGGCTCTTTTGTTCAAGCTGTGCTTGCTGATGCCAAACCTATCAAAGTTGGACCACCTCCCCCACCTTCTGGCGGATTACCTGGAACATTGAACTCAGATGAACCAAGAGACCTTAAGCTGCCATTGAAAGATAGGTTCTTCCTTCAACCATTGTCTCCAACTGATGCTGCACAAAGGGCAAAGGAATCAGCCAAGGAAATTGTTGGCGTTAAGAAGTTGATTGAAAAGAAGGCTTGGCCATATGTTCAGAATGATCTGCGTCTCAGGGCCGAGTATCTGCGCTTTGATCTCAACACTGTCATTGCTGCAAAGCCTAAGGATGAGAAGAAATCACTCAAGGAACTCACTGGCAAGCTCTTCCAGGATATCAGCAATCTGGATCATGCAGCAAAAATTAAGAGCAGCCCGGAAGCAGAGAAGTACTATGCTGCTACTGTATCTTCTCTGAACGATGTCCTTGCCAAACTTGGTTAA

>Glyma03g26740.1   sequence type=predicted peptide   gene model=Glyma03g26740   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQAMASMTSLRGSSQAVLEGSLGSTRLNVGSGSRVASVTRAGFTVRAQQQQVNGGEVQSSRRAVLSLVAAGLTTGSFVQAVLADAKPIKVGPPPPPSGGLPGTLNSDEPRDLKLPLKDRFFLQPLSPTDAAQRAKESAKEIVGVKKLIEKKAWPYVQNDLRLRAEYLRFDLNTVIAAKPKDEKKSLKELTGKLFQDISNLDHAAKIKSSPEAEKYYAATVSSLNDVLAKLG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo