Glyma03g26690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26690

Feature Type:	gene_model
Chromosome:	Gm03
Start:	34158763
stop:	34163889
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g26690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G01710	AT	Annotation by Michelle Graham. TAIR10: ARP2/3 complex 16 kDa subunit (p16-Arc) \| chr4:735776-736450 FORWARD LENGTH=132	SoyBase	E_val: 9.00E-74	ISS
GO:0007015	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament organization	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0010090	GO-bp	Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis	SoyBase	N/A	ISS
GO:0030036	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization	SoyBase	N/A	ISS
GO:0030041	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament polymerization	SoyBase	N/A	ISS
GO:0030833	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of actin filament polymerization	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005856	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoskeleton	SoyBase	N/A	ISS
GO:0005885	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Arp2/3 protein complex	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
KOG3380	KOG	Actin-related protein Arp2/3 complex, subunit ARPC5	JGI		ISS
PTHR12644	Panther	ARP2/3 COMPLEX 16 KD SUBUNIT (P16-ARC)	JGI		ISS
PF04699	PFAM	ARP2/3 complex 16 kDa subunit (p16-Arc)	JGI		ISS
UniRef100_I1JMT0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Actin-related protein 2/3 complex subunit 5 n=1 Tax=Glycine max RepID=I1JMT0_SOYBN	SoyBase	E_val: 5.00E-94	ISS

Expression Patterns of Glyma03g26690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26690 not represented in the dataset	Glyma03g26690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g26690

Paralog	Evidence	Comments
Glyma07g14260	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g26690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g114200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g26690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g26690

Limit To All Plant Sequences

>Glyma03g26690.1   sequence type=CDS   gene model=Glyma03g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGAGCAAAAGGGTTCGTTGAAGCAGATAATGCAGAGGCCATAATTACCAGAATTGAACACAAATCGCGAAAGATCGAAACTTTGCTCAAACAGTATAAGCCCGTGGAAGCCCTTAAAACTGCCCTTGAAGGCACATTTGCCATCATTGGGGATGAGCGTTGCAAGTCGGCACACTGGCTTGTGGTGCACAGAGCTATAATGGCTATAAAAGATGTGGATGGGATGCTTTCTTCCTTGGATCCTGAGTACTATGATATCCTAATGAAGTACTTGTATAGAGGCTTAGCTACCGGAGATCGCCCGACCTGTGACCAATGTCTTCTGATTCATGAAAAATTGACAGAGAAAGCAGGACTAGGTTGCATCCTACGTTTCCTCACAGATATTGTAAATACAGTTTGA

Predicted protein sequences of Glyma03g26690

Limit To All Plant Sequences

>Glyma03g26690.1   sequence type=predicted peptide   gene model=Glyma03g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGAKGFVEADNAEAIITRIEHKSRKIETLLKQYKPVEALKTALEGTFAIIGDERCKSAHWLVVHRAIMAIKDVDGMLSSLDPEYYDILMKYLYRGLATGDRPTCDQCLLIHEKLTEKAGLGCILRFLTDIVNTV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain