SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26680

Feature Type:gene_model
Chromosome:Gm03
Start:34154032
stop:34159067
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G60370AT Annotation by Michelle Graham. TAIR10: FKBP-like peptidyl-prolyl cis-trans isomerase family protein | chr3:22315000-22316533 REVERSE LENGTH=242 SoyBaseE_val: 2.00E-107ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0018208GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
GO:0005528GO-mf Annotation by Michelle Graham. GO Molecular Function: FK506 binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
KOG0544 KOG FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR10516Panther FK506 BINDING PROTEIN JGI ISS
PF00254PFAM FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
UniRef100_I1JMS9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1JMS9_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1JMS9UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=I1JMS9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26680 not represented in the dataset

Glyma03g26680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g14250 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g114100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g26680.1   sequence type=CDS   gene model=Glyma03g26680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTTGGCGTCTTTTCGTTCGAACTTCCCTTGTGCTGTACAAGGAACTGTATTTTGTCAAAGGAAGCAATTAACTCATGGATGCACAAACCAAAAATCAAAGGATTACATTGTGCAGGATAGCTGCATGTTACAGCATTCGGAGAAAGCATTGAGGAGGACACTTTTCCTTTCTGTCTTGGTCTCAGCTGGTGTTTTTCCAACTTTGTCGTCTTATGGCAAGACAAAGAGTAAGAATCCGTATGATGAAAAACGGTTGCTTCAACAAAATCGGCGGATACAGAAAGAAAACAATGCGCCAGAGGACTTCCCAAATTTTGTTAGAGAAGGTTTTCAAGTTAAAGTAGTATCATCAGATAACTATATAAAGAGTGATTCAGGGCTCATATACCGAGATTTTGTAGTTGGTCAAGGTGATTGCCCAAAGGATGGTCAGCAGGTTACTTTTCACTATATTGGCTATAATGAATCTGGCCGTCGTATTGACAGCACTTATTTGCAGGGTACTCCAGCCAAAATCCGTATGGGCACCAAGGGATTGGTTCCAGGATTTGAGGAAGGAATTAGAGACATGAGACCAGGTGGGAAGAGAAGAATCATTATTCCCCCTGAACTTGGACCACCAGTAGGACCTTCAACCTTTTTCAGCTCAAAACAGTTTGAAGTTTTTGATGTTGAGCTATTAAGCGTACAAAACTGTGAAAGAAGAACCATAGCCTTTTACTCAGATGTTGTATGCAATTGA

>Glyma03g26680.1   sequence type=predicted peptide   gene model=Glyma03g26680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLASFRSNFPCAVQGTVFCQRKQLTHGCTNQKSKDYIVQDSCMLQHSEKALRRTLFLSVLVSAGVFPTLSSYGKTKSKNPYDEKRLLQQNRRIQKENNAPEDFPNFVREGFQVKVVSSDNYIKSDSGLIYRDFVVGQGDCPKDGQQVTFHYIGYNESGRRIDSTYLQGTPAKIRMGTKGLVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSSKQFEVFDVELLSVQNCERRTIAFYSDVVCN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo