SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26090): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26090

Feature Type:gene_model
Chromosome:Gm03
Start:33434439
stop:33438582
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02130AT Annotation by Michelle Graham. TAIR10: RAS 5 | chr1:400350-401788 REVERSE LENGTH=203 SoyBaseE_val: 2.00E-140ISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0000139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0032588GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0084 KOG GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF227Panther SUBFAMILY NOT NAMED JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_C6SY63UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SY63_SOYBN SoyBaseE_val: 3.00E-148ISS
UniRef100_Q08154UniRef Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein n=1 Tax=Pisum sativum RepID=Q08154_PEA SoyBaseE_val: 5.00E-145ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26090 not represented in the dataset

Glyma03g26090 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g13890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g110200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g26090.1   sequence type=CDS   gene model=Glyma03g26090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCCGAGTATGACTATCTGTTCAAGCTCCTTCTGATTGGAGACTCTGGTGTTGGTAAATCATGCCTTCTTCTAAGATTTGCTGATGATTCATACATTGAGAGCTACATAAGCACCATCGGAGTTGATTTTAAAATTCGCACTGTTGAGCAGGATGGGAAGACAATTAAACTACAGATTTGGGATACTGCTGGACAAGAACGATTTAGGACAATAACTAGTAGCTACTATCGTGGAGCACATGGAATCATTATTGTTTATGACGTGACAGATGAAGATAGCTTCAATAATGTGAAGCAATGGCTCAGTGAAATTGACCGCTATGCCAGTGATAATGTTAACAAACTTTTGGTTGGAAACAAGAGTGATCTGACAGCAAATAGAGTTGTCTCATATGACACAGCTAAGGAATTCGCAGATCAAATTGGCATACCTTTCATGGAAACAAGTGCAAAAGATGCTACAAATGTGGAAGATGCTTTCATGGCCATGTCTGCTGCCATCAAGAATAGAATGGCTAGTCAGCCTTCAGCAAACAATGCAAGGCCTCCAACAGTGCAGATCAGAGGGCAACCTGTTGGACAAAAAAGTGGTTGCTGCTCTTCCTAA

>Glyma03g26090.1   sequence type=predicted peptide   gene model=Glyma03g26090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEDSFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTANRVVSYDTAKEFADQIGIPFMETSAKDATNVEDAFMAMSAAIKNRMASQPSANNARPPTVQIRGQPVGQKSGCCSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo