SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g26080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g26080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g26080

Feature Type:gene_model
Chromosome:Gm03
Start:33409595
stop:33414163
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07320AT Annotation by Michelle Graham. TAIR10: ribosomal protein L4 | chr1:2249190-2250189 FORWARD LENGTH=280 SoyBaseE_val: 8.00E-109ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0000311GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid large ribosomal subunit SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009547GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid ribosome SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0008266GO-mf Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding SoyBaseN/AISS
KOG1624 KOG Mitochondrial/chloroplast ribosomal protein L4 JGI ISS
PTHR10746Panther 50S RIBOSOMAL PROTEIN L4 JGI ISS
PF00573PFAM Ribosomal protein L4/L1 family JGI ISS
UniRef100_B9SHY1UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L4, putative n=1 Tax=Ricinus communis RepID=B9SHY1_RICCO SoyBaseE_val: 9.00E-116ISS
UniRef100_I1JMQ2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMQ2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g26080 not represented in the dataset

Glyma03g26080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g13880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g110100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g26080.1   sequence type=CDS   gene model=Glyma03g26080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCACTTTCCCTCTCTCTCTCCACACCAACAACACCAACCTCACTCTCCTTCACATCATCCTCCATCTTCTTCTCTTCACACCAATTCCACACACACAATAATTCTTTCAAATCCAACAGCTTTCCCGTTTTACCCTCCAAAAAACCCCTCTCCATTTCCTGCAAGGCCTCCCCTCCTCTTCCCGTCCTCAACTTCTCCGGCGAGAGGGTCGGCGAGTCCTTCCTCGACCTCCGCTCCGCCCCTCCCGACACCGCCCGAGCCGTCGTCCACCGCGCCGTCGTCACCGACCTCCAGAACAAGCGCCGCGGCACCGCCTCCACCCTCACCCGCGGAGAGGTCCGAGGCGGCGGACGGAAGCCCTTCCCGCAGAAAAAAACCGGTCGCGCCCGCCGCGGCTCCAACCGCACGCCCCTCCGCCCCGGCGGAGGCGTCATCTTCGGCCCGAAGCCCCGCGACTGGTCCATCAAGATCAACCGCAAGGAGAAGCGCCTCGCCATCTCCACCGCTGTTGCCAGCGCTGCCGCCAGTGCCGTCGTGGTGGAGGACTTCGCAGCGGAGTTCGCCGAGAAGCCGAAGACGAAGGAGTTCATCGCGGCGATGAAGCGGTGGGGGCTCGACCCGAAGGAGAAGGCGATGTTCTTGATGACGGAGGTGCCGGAGAACGTGAGGCTATCGAGCAGGAACATTGGGACCTTGAAGATGCACACGCCGAGGACACTGAATTTGTATGATATTCTTGATGCGGATAAGCTTGTGCTCACGCAGGGTGCTGTGGATTACTTGAATCAGAGGTATGGGGGTGATTATCAAGGGAGTGATGATGAAGATGAAGAAGAAGAAGAAGAGGGATATGAAGAGGGTGAGGAGGAAGGTGTAGTGGATGGTGAAGAAGGACCTGACGCAGGGGATAGTGATGTGGTAAATTGA

>Glyma03g26080.1   sequence type=predicted peptide   gene model=Glyma03g26080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLSLSLSTPTTPTSLSFTSSSIFFSSHQFHTHNNSFKSNSFPVLPSKKPLSISCKASPPLPVLNFSGERVGESFLDLRSAPPDTARAVVHRAVVTDLQNKRRGTASTLTRGEVRGGGRKPFPQKKTGRARRGSNRTPLRPGGGVIFGPKPRDWSIKINRKEKRLAISTAVASAAASAVVVEDFAAEFAEKPKTKEFIAAMKRWGLDPKEKAMFLMTEVPENVRLSSRNIGTLKMHTPRTLNLYDILDADKLVLTQGAVDYLNQRYGGDYQGSDDEDEEEEEEGYEEGEEEGVVDGEEGPDAGDSDVVN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo