Glyma03g25820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25820

Feature Type:	gene_model
Chromosome:	Gm03
Start:	33199767
stop:	33202047
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g25820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G09320	AT	Annotation by Michelle Graham. TAIR10: Nucleoside diphosphate kinase family protein \| chr4:5923424-5924366 FORWARD LENGTH=169	SoyBase	E_val: 7.00E-90	ISS
GO:0006165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleoside diphosphate phosphorylation	SoyBase	N/A	ISS
GO:0006183	GO-bp	Annotation by Michelle Graham. GO Biological Process: GTP biosynthetic process	SoyBase	N/A	ISS
GO:0006228	GO-bp	Annotation by Michelle Graham. GO Biological Process: UTP biosynthetic process	SoyBase	N/A	ISS
GO:0006241	GO-bp	Annotation by Michelle Graham. GO Biological Process: CTP biosynthetic process	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004550	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside diphosphate kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
KOG0888	KOG	Nucleoside diphosphate kinase	JGI		ISS
PTHR11349	Panther	NUCLEOSIDE DIPHOSPHATE KINASE	JGI		ISS
PF00334	PFAM	Nucleoside diphosphate kinase	JGI		ISS
UniRef100_I1JMQ0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Nucleoside diphosphate kinase n=1 Tax=Glycine max RepID=I1JMQ0_SOYBN	SoyBase	E_val: 3.00E-104	ISS
UniRef100_I1JMQ0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleoside diphosphate kinase n=1 Tax=Glycine max RepID=I1JMQ0_SOYBN	SoyBase	E_val: 3.00E-104	ISS

Expression Patterns of Glyma03g25820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25820 not represented in the dataset	Glyma03g25820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g25820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g109500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g25820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g25820

Limit To All Plant Sequences

>Glyma03g25820.1   sequence type=CDS   gene model=Glyma03g25820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGCAAACCTTCATCATGATCAAGCCTGATGGCGTCCAAAGAGGCCTTATTGGCGAGATCATTAGCAGATTTGAGAAGAAAGGTTTCTACTTGAAAGGTTTGAAACTTGTTACTGTGGACCGTCCTTTTGCTGAGAAGCACTATGCTGATTTGTCTGCCAAGCCTTTCTTTAGTGGTTTGGTGGATTACATTATCTCTGGCCCTGTTGTTGCCATGATCTGGGAGGGCAAGAATGTTGTTACAACTGGCCGAAAGATTATCGGAGCCACAAACCCAGCTCAATCTGAGCCTGGAACTATCCGTGGTGACTTTGCCATTGACATTGGAAGGAATGTTATCCATGGAAGTGATGCAATTGAAAGTGCTAACAAGGAAATTGCATTGGGGGTTCCTGAGGGCCCTGCTAACTGGCAAAGCTCCCAACACTCTTGGATCTATGAGTAA

Predicted protein sequences of Glyma03g25820

Limit To All Plant Sequences

>Glyma03g25820.1   sequence type=predicted peptide   gene model=Glyma03g25820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEQTFIMIKPDGVQRGLIGEIISRFEKKGFYLKGLKLVTVDRPFAEKHYADLSAKPFFSGLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDAIESANKEIALGVPEGPANWQSSQHSWIYE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain