SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25640

Feature Type:gene_model
Chromosome:Gm03
Start:32864729
stop:32867220
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g25640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44740AT Annotation by Michelle Graham. TAIR10: cyclin p4;1 | chr2:18442287-18443304 REVERSE LENGTH=202 SoyBaseE_val: 1.00E-99ISS
GO:0010440GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0004693GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1674 KOG Cyclin JGI ISS
PTHR15615Panther UNCHARACTERIZED JGI ISS
PF08613PFAM Cyclin JGI ISS
UniRef100_G7KTC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclin-dependent protein kinase regulator Pho80 n=1 Tax=Medicago truncatula RepID=G7KTC0_MEDTR SoyBaseE_val: 3.00E-119ISS
UniRef100_I1JMN2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMN2_SOYBN SoyBaseE_val: 2.00E-153ISS

Expression Patterns of Glyma03g25640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25640 not represented in the dataset
Glyma03g25640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g25640
ParalogEvidenceComments
Glyma07g13200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g25640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g107800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g25640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g25640
>Glyma03g25640.1   sequence type=CDS   gene model=Glyma03g25640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCATAGCAGAGGAGGAGAGTCCAAGTGTGATGCCAAAAGTGATCACTTTCCTCTGCTCTCTTCTTGAGAGGGTGGCTGAGTCAAATGATCACAACCAACACCTCCAACAGCACCAGAAGATCTCAGTGTTCCATGGCCTGACAAGGCCAAACATCTCAATTCAGTGCTATCTTGAGAGAATCTTCAAGTACGCGAATTGCAGCCCTTCATGCTTCGTCGTCGCCTACGTCTACCTCGATCGATTCACTCAGAGACAACCCTCTTTGCCCATCAACTCCTTCAACGTGCACCGTTTACTGATCACTAGTGTCATGGTAGCTGCCAAGTTCATGGATGACATGTTCTACAACAATGCTCACTATGCCAAAGTTGGAGGAATCACCAAAGTAGAGATGAATTTTCTTGAGTTGGATTTCCTCTTTGGTTTGGGTTTCCATTTAAATGTGACCCCAGGCACCTTCCAAGCCTATTGTGTCCATCTCCAAAGAGAAATGTTGTTGATCCAACCTCTAAATTTTTCAGATTCCACCCTAAATTTAGGACAATCACTAAAGGCTCACTTGTGCTTCAATGAGGATGAATGTTCTCATCAAAAGCAGAAACAACAACAACAGCTAGCTGTTTGA
Predicted protein sequences of Glyma03g25640
>Glyma03g25640.1   sequence type=predicted peptide   gene model=Glyma03g25640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSIAEEESPSVMPKVITFLCSLLERVAESNDHNQHLQQHQKISVFHGLTRPNISIQCYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMFYNNAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCVHLQREMLLIQPLNFSDSTLNLGQSLKAHLCFNEDECSHQKQKQQQQLAV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo