Glyma03g25541 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25541

Feature Type:	gene_model
Chromosome:	Gm03
Start:	32734378
stop:	32735319
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g25541

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G58290	AT	Annotation by Michelle Graham. TAIR10: regulatory particle triple-A ATPase 3 \| chr5:23569155-23571116 FORWARD LENGTH=408	SoyBase	E_val: 3.00E-49	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009735	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0030163	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein catabolic process	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043161	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0043248	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome assembly	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0008540	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, base subcomplex	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
PTHR23073	Panther	26S PROTEASE REGULATORY SUBUNIT	JGI		ISS
PTHR23073:SF8	Panther	26S PROTEASE REGULATORY SUBUNIT 6B	JGI		ISS
PF00004	PFAM	ATPase family associated with various cellular activities (AAA)	JGI		ISS
UniRef100_P85200	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit 6B homolog n=1 Tax=Helianthus annuus RepID=PRS6B_HELAN	SoyBase	E_val: 1.00E-46	ISS
UniRef100_P85200	UniRef	Annotation by Michelle Graham. Best UniRef hit: 26S protease regulatory subunit 6B homolog n=1 Tax=Helianthus annuus RepID=PRS6B_HELAN	SoyBase	E_val: 1.00E-46	ISS

Expression Patterns of Glyma03g25541

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25541 not represented in the dataset	Glyma03g25541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g25541 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g25541

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g25541

Limit To All Plant Sequences

>Glyma03g25541.1   sequence type=CDS   gene model=Glyma03g25541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCCCGGGACATTGGAGGATGTGATATACAAAAACAGGATATCCACGAGGCTGTGGAGCTACCCCCTACACATCATGAACTATACAAACAAATTGGTATTGATCCTCCCCATGGTGTTTTACTGTATGGACCCCCTGGCACTGGTAAAACAATGCTTGCCAAAGCTGTTGTGAATCATACCACTGCTGCCTTCATCAGGGTTGTGGGATCTGAGTTTGTGCAGAAGTATGTTGGTGAGGGTCCACGAATGAAACAACTTTGTTAA

Predicted protein sequences of Glyma03g25541

Limit To All Plant Sequences

>Glyma03g25541.1   sequence type=predicted peptide   gene model=Glyma03g25541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSRDIGGCDIQKQDIHEAVELPPTHHELYKQIGIDPPHGVLLYGPPGTGKTMLAKAVVNHTTAAFIRVVGSEFVQKYVGEGPRMKQLC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain