|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G58290 | AT | Annotation by Michelle Graham. TAIR10: regulatory particle triple-A ATPase 3 | chr5:23569155-23571116 FORWARD LENGTH=408 | SoyBase | E_val: 3.00E-49 | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0006635 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation | SoyBase | N/A | ISS |
| GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0007010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0009407 | GO-bp | Annotation by Michelle Graham. GO Biological Process: toxin catabolic process | SoyBase | N/A | ISS |
| GO:0009735 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus | SoyBase | N/A | ISS |
| GO:0009853 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photorespiration | SoyBase | N/A | ISS |
| GO:0010498 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process | SoyBase | N/A | ISS |
| GO:0030163 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein catabolic process | SoyBase | N/A | ISS |
| GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS |
| GO:0043161 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0043248 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome assembly | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
| GO:0080129 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly | SoyBase | N/A | ISS |
| GO:0000502 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0008540 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, base subcomplex | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016787 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| PTHR23073 | Panther | 26S PROTEASE REGULATORY SUBUNIT | JGI | ISS | |
| PTHR23073:SF8 | Panther | 26S PROTEASE REGULATORY SUBUNIT 6B | JGI | ISS | |
| PF00004 | PFAM | ATPase family associated with various cellular activities (AAA) | JGI | ISS | |
| UniRef100_P85200 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit 6B homolog n=1 Tax=Helianthus annuus RepID=PRS6B_HELAN | SoyBase | E_val: 1.00E-46 | ISS |
| UniRef100_P85200 | UniRef | Annotation by Michelle Graham. Best UniRef hit: 26S protease regulatory subunit 6B homolog n=1 Tax=Helianthus annuus RepID=PRS6B_HELAN | SoyBase | E_val: 1.00E-46 | ISS |
|
Glyma03g25541 not represented in the dataset |
Glyma03g25541 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g25541.1 sequence type=CDS gene model=Glyma03g25541 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATTCCCGGGACATTGGAGGATGTGATATACAAAAACAGGATATCCACGAGGCTGTGGAGCTACCCCCTACACATCATGAACTATACAAACAAATTGGTATTGATCCTCCCCATGGTGTTTTACTGTATGGACCCCCTGGCACTGGTAAAACAATGCTTGCCAAAGCTGTTGTGAATCATACCACTGCTGCCTTCATCAGGGTTGTGGGATCTGAGTTTGTGCAGAAGTATGTTGGTGAGGGTCCACGAATGAAACAACTTTGTTAA
>Glyma03g25541.1 sequence type=predicted peptide gene model=Glyma03g25541 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDSRDIGGCDIQKQDIHEAVELPPTHHELYKQIGIDPPHGVLLYGPPGTGKTMLAKAVVNHTTAAFIRVVGSEFVQKYVGEGPRMKQLC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||