SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25371): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25371

Feature Type:gene_model
Chromosome:Gm03
Start:32498237
stop:32501149
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26910AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L16p/L10e family protein | chr1:9321709-9322813 FORWARD LENGTH=221 SoyBaseE_val: 2.00E-85ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG0857 KOG 60s ribosomal protein L10 JGI ISS
PTHR11726Panther 60S RIBOSOMAL PROTEIN L10 JGI ISS
PTHR11726:SF9Panther 60S RIBOSOMAL PROTEIN L10-LIKE JGI ISS
PF00252PFAM Ribosomal protein L16p/L10e JGI ISS
UniRef100_B9SED8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L10, putative n=1 Tax=Ricinus communis RepID=B9SED8_RICCO SoyBaseE_val: 2.00E-89ISS
UniRef100_UPI00023375B0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023375B0 related cluster n=1 Tax=unknown RepID=UPI00023375B0 SoyBaseE_val: 2.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25371 not represented in the dataset

Glyma03g25371 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g106300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g25371.1   sequence type=CDS   gene model=Glyma03g25371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGTGGGACCTGCAAGATGTTGCCGACAAATTAAAAACAAACCATACCAGAAATCGCGGTTTTGCCACGGTGTTCCTGATCCCAAGATCAGGATTTATGATGTTGGCATGAAGAAGAAAGGTGTTGATGAGTTTCCTTTCTGTGTGCATTTGGTTAGTTGGGAGAAGGATGCATTCCACTTGAGAGTCAGGCTGCATCACTTCCATGTTCTTAGGATCAACAAAATGCTTTCATGTGCCAGAGCCGATACGCTCCAGACCGGGATGCGAGGTGAATTTGGAAAGCCGCTGGGTACTTGTGCTACAGTGGCTATTGGCCAGGTCCTCCTTTCTGTCCGCCGTATGGACTGCAACAGCCATCATGCACAAGAGGCCCTCATCGAGCTAAATTTGCACCTTTTTCTTTTGTGCATGTTTGGCCTTAATGATTTTTTGAAGTTAAAGTCAGAGTACAGGATTATGCCTGATGGTGTGAATGCCAAGCTTCTTGGGTGCCATGGACCATTGGCTAACTGCCAACCAGGAAGAGCCTTTTTGTCTAGGGCTACTGCATAG

>Glyma03g25371.1   sequence type=predicted peptide   gene model=Glyma03g25371   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVGPARCCRQIKNKPYQKSRFCHGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKDAFHLRVRLHHFHVLRINKMLSCARADTLQTGMRGEFGKPLGTCATVAIGQVLLSVRRMDCNSHHAQEALIELNLHLFLLCMFGLNDFLKLKSEYRIMPDGVNAKLLGCHGPLANCQPGRAFLSRATA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo