SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25190): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25190

Feature Type:gene_model
Chromosome:Gm03
Start:32223793
stop:32227423
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G47030AT Annotation by Michelle Graham. TAIR10: ATPase, F1 complex, delta/epsilon subunit | chr5:19090384-19092034 FORWARD LENGTH=203 SoyBaseE_val: 2.00E-99ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0015986GO-bp Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000275GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex, catalytic core F(1) SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005753GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase complex SoyBaseN/AISS
GO:0045261GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, catalytic core F(1) SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046933GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism SoyBaseN/AISS
GO:0046961GO-mf Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism SoyBaseN/AISS
KOG1758 KOG Mitochondrial F1F0-ATP synthase, subunit delta/ATP16 JGI ISS
PTHR13822Panther ATP SYNTHASE DELTA/EPSILON CHAIN JGI ISS
PF02823PFAM ATP synthase, Delta/Epsilon chain, beta-sandwich domain JGI ISS
UniRef100_G7LCJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase delta subunit n=1 Tax=Medicago truncatula RepID=G7LCJ4_MEDTR SoyBaseE_val: 9.00E-111ISS
UniRef100_I1JML1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JML1_SOYBN SoyBaseE_val: 4.00E-139ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25190 not represented in the dataset

Glyma03g25190 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g13470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g105300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g25190.1   sequence type=CDS   gene model=Glyma03g25190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCGCCGCGCAACCTCCTCCCTCCTCACCGGCGCCTCCCGCCGCCGCCTCTCCTCCGACGTGCCGGCGACCCCCGCCGCGGATTCCGCCTTCGCGGAGGCGTGGAAGAAAGTGAGCCCCAACATCGACCCGCCGAAGACGCCGCTGGCGTACATGAAGCCCCGACCACCCACTCCCTCGGCTCTCCCTTCCAAGCTCACAGTCAACTTCGTCTTGCCCTACTCTTCTCAATTGGCCGCAAAAGAGGTTGATATGGTCATTGTACCAGCAACAACTGGGCAGATGGGTGTTCTCCCAGGACATGTAGCAACAATTGCAGAGTTGAAACCTGGTGTCTTATCTGTACATGAAGGGAACGATGTGACCAAGTACTTTGTCAGCAGTGGCTTTGCATTCATCCATGCAAACTCTGTTGCTGATATAATAGCTGTTGAGGCTGTGCCGGTGGACCGAATTGATGCGAATCTAGTCCAGAAGGGTCTTCAAGATTTCACCCAGAAGCTGAACTCAGCCACAACTGATTTGGAGAAAGCTGAAGCTCAGATTGGGGTTGATGTCCATAGTGCTCTGAACTCTGCTCTTACAGGCTAA

>Glyma03g25190.1   sequence type=predicted peptide   gene model=Glyma03g25190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRRATSSLLTGASRRRLSSDVPATPAADSAFAEAWKKVSPNIDPPKTPLAYMKPRPPTPSALPSKLTVNFVLPYSSQLAAKEVDMVIVPATTGQMGVLPGHVATIAELKPGVLSVHEGNDVTKYFVSSGFAFIHANSVADIIAVEAVPVDRIDANLVQKGLQDFTQKLNSATTDLEKAEAQIGVDVHSALNSALTG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo