Glyma03g25050 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g25050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g25050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g25050

Feature Type:	gene_model
Chromosome:	Gm03
Start:	32023371
stop:	32023603
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g25050

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G55770	AT	Annotation by Michelle Graham. TAIR10: GATA type zinc finger transcription factor family protein \| chr3:20703799-20704614 FORWARD LENGTH=127	SoyBase	E_val: 2.00E-17	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0051017	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly	SoyBase	N/A	ISS
GO:0051049	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0015629	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0051015	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin filament binding	SoyBase	N/A	ISS
UniRef100_F4IY33	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GATA type zinc finger transcription factor-like protein n=1 Tax=Arabidopsis thaliana RepID=F4IY33_ARATH	SoyBase	E_val: 1.00E-14	ISS
UniRef100_I1N6F9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N6F9_SOYBN	SoyBase	E_val: 3.00E-18	ISS

Expression Patterns of Glyma03g25050

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g25050 not represented in the dataset	Glyma03g25050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g25050 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g25050

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g25050

Limit To All Plant Sequences

>Glyma03g25050.1   sequence type=CDS   gene model=Glyma03g25050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTGAGCAACTATTCCTCAATGGAAGGTGTTCTTTATTGTAAGCCTCACTTTGAGCATCTCTTCAAGGAGAGTGGGTCCTTCAGCAAGAACTTCCAAATGAAGCTGTGTTTGTGTGCTGCAAAGCTAGCTGATAAGACAACACATGAGCTG

Predicted protein sequences of Glyma03g25050

Limit To All Plant Sequences

>Glyma03g25050.1   sequence type=predicted peptide   gene model=Glyma03g25050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LSNYSSMEGVLYCKPHFEHLFKESGSFSKNFQMKLCLCAAKLADKTTHEL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain