SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g24541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g24541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g24541

Feature Type:gene_model
Chromosome:Gm03
Start:31392662
stop:31393454
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g24541
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07050AT Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr5:2191533-2193416 REVERSE LENGTH=402 SoyBaseE_val: 3.00E-27ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF00892PFAM EamA-like transporter family JGI ISS
UniRef100_B9SHS8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4, putative n=1 Tax=Ricinus communis RepID=B9SHS8_RICCO SoyBaseE_val: 1.00E-26ISS
UniRef100_C6TDP5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TDP5_SOYBN SoyBaseE_val: 9.00E-63ISS

Expression Patterns of Glyma03g24541
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g24541 not represented in the dataset
Glyma03g24541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g24541 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g102300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g24541
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g24541
>Glyma03g24541.1   sequence type=CDS   gene model=Glyma03g24541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTAAGGGATTGTCATGCAGAAAAAGGCATGTTTTCGTTACTGCTTTCAGCCCTTTGATGATGATTATCGTAGCCATCATGGGTGCCTTCATCCTTGCAGAAAAAATATATCTTGGAGGGGTCATTGGAGCTATTCTAATAGTAATGGGACTCTACTCGGTTCTATGGGGAAAGCACAAGGAGAACAAAGAGAAACAGGCAGAGATAACCATTGAGTTATTGAAGTGTTGTTCAGAAAATGGGATGACGTTGGAGACTGTGGTAGAAGATGCTGAAACAAACAACGACATTGACATGCAAAAGGGTGAAGCCTCAAGAGAGTTAAGGGTAGCCATTGTTGTTCCAAAAGTTTAA
Predicted protein sequences of Glyma03g24541
>Glyma03g24541.1   sequence type=predicted peptide   gene model=Glyma03g24541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFKGLSCRKRHVFVTAFSPLMMIIVAIMGAFILAEKIYLGGVIGAILIVMGLYSVLWGKHKENKEKQAEITIELLKCCSENGMTLETVVEDAETNNDIDMQKGEASRELRVAIVVPKV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo