SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g24521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g24521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g24521

Feature Type:gene_model
Chromosome:Gm03
Start:31391306
stop:31391682
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g24521
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26440AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF707) | chr3:9677418-9679494 FORWARD LENGTH=373 SoyBaseE_val: 8.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PF05212PFAM Protein of unknown function (DUF707) JGI ISS
UniRef100_A8MQR2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3G26440 protein n=1 Tax=Arabidopsis thaliana RepID=A8MQR2_ARATH SoyBaseE_val: 4.00E-30ISS
UniRef100_C6TLL2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TLL2_SOYBN SoyBaseE_val: 4.00E-34ISS

Expression Patterns of Glyma03g24521
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g24521 not represented in the dataset
Glyma03g24521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g24521 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g102200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g24521
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g24521
>Glyma03g24521.1   sequence type=CDS   gene model=Glyma03g24521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTCTTTTAACTAAGAATTTGCTTTTACAGTTTTTAGGGAACTTCACTATTCTGCTATTTCATTATGATGGCCGAACTACTGAATGGGATGAGTTTGAATGGTCAAAGCAGGCTATTCATATGAGTGTTCGCAAACAAACCAAATGGTGGTATGCCAAGCGGTTTTTGCATCCTGACATTGTGGCACCATATGACTATATATTAATATGGGATCAAAGAAAATGGGTGTTTGAGGTGTTATGA
Predicted protein sequences of Glyma03g24521
>Glyma03g24521.1   sequence type=predicted peptide   gene model=Glyma03g24521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCLLTKNLLLQFLGNFTILLFHYDGRTTEWDEFEWSKQAIHMSVRKQTKWWYAKRFLHPDIVAPYDYILIWDQRKWVFEVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo