Glyma03g24490 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g24490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g24490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g24490

Feature Type:	gene_model
Chromosome:	Gm03
Start:	31342465
stop:	31344975
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g24490

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G02205	AT	Annotation by Michelle Graham. TAIR10: Fatty acid hydroxylase superfamily \| chr1:419650-422154 FORWARD LENGTH=461	SoyBase	E_val: 2.00E-69	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0010025	GO-bp	Annotation by Michelle Graham. GO Biological Process: wax biosynthetic process	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043447	GO-bp	Annotation by Michelle Graham. GO Biological Process: alkane biosynthetic process	SoyBase	N/A	ISS
GO:0046185	GO-bp	Annotation by Michelle Graham. GO Biological Process: aldehyde catabolic process	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0071771	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aldehyde decarbonylase activity	SoyBase	N/A	ISS
PTHR11863	Panther	STEROL DESATURASE	JGI		ISS
PTHR11863:SF1	Panther	ACID PHOSPHATASE-RELATED	JGI		ISS
PF12076	PFAM	WAX2 C-terminal domain	JGI		ISS
UniRef100_G7LDH6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gl1-like protein n=1 Tax=Medicago truncatula RepID=G7LDH6_MEDTR	SoyBase	E_val: 5.00E-68	ISS
UniRef100_I1JMI1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JMI1_SOYBN	SoyBase	E_val: 6.00E-97	ISS

Expression Patterns of Glyma03g24490

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g24490 not represented in the dataset	Glyma03g24490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g24490 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g24490

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g24490

Limit To All Plant Sequences

>Glyma03g24490.1   sequence type=CDS   gene model=Glyma03g24490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCACTCATTGCATCATACCCAGTTTAGGACAAATTATTGCTTATTTATGCCATTTTATGACTACATCTATGGTACCATGGATAAGGCTTCAGATCAATTACATGATTCAGCAATAAAACAAGAGGAAGAAATCCCAGATGTTGTGCACCTAGCACATCTCACAACTCCTGAATGGTGGCTTTGTTTGATGCGGCCAGTAACAGCTTGGTCCATGATCCTCACATGGGTTTATGGTCAAACATTTATCGTAGAAGGAAATCGTTTTGACAAACTCAAGCTGCAAACTAGAGCAATACCCAAATACAGTTTCCAAAAATTTATACCATTTGCAATCGCAAAAAATGACCGTCAACAAAATAATAGAGGAAAAGTGTTGAGTCTAGGCCTCATGAATCAAGGAGAGGAGCTTAACATATGTATATGGAGGAATATATATTACAAGGCTTCCAAAGCTAAAACATTCCCAAAGGAACAACTCATGTATTACTCGGGCAAACTCACCTTTGCTCTTGCCTTCCCATTGTGTCAACAAGGCATTAAGGGACACATGATACCCCTCCTCTATTCCTCATGCGTGGATCCTTGTTTACATCTCACGTTGCAATTTTGCACACCCTTCTTTGTTTATCAAATCACACACCCTTCTCTACATTGGATTTGGTTAGTTGGGGACGAATTGACTGAAGAAGAACAATTAAAGGTACCGAAAGGAGCATTTTTTATTCCATTCTCGCAATTCCCACCAAGGAAATACCGTAAGGATTGCTCCTACCAATACACCCCAGCAATGCTAGTTCCAAGTATTCTTGAAAATGTTCATTCTTGTGAGGTTTGTTCAAATAATCTTTTCTTTGTTCAGTGGAGTGACATGATTTGGCTTTCAACACTTCAACATGGGTTTCAACCACTTACTGTGCCAATCAAAGAGTTTGCTCATTGTTAA

Predicted protein sequences of Glyma03g24490

Limit To All Plant Sequences

>Glyma03g24490.1   sequence type=predicted peptide   gene model=Glyma03g24490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FHSLHHTQFRTNYCLFMPFYDYIYGTMDKASDQLHDSAIKQEEEIPDVVHLAHLTTPEWWLCLMRPVTAWSMILTWVYGQTFIVEGNRFDKLKLQTRAIPKYSFQKFIPFAIAKNDRQQNNRGKVLSLGLMNQGEELNICIWRNIYYKASKAKTFPKEQLMYYSGKLTFALAFPLCQQGIKGHMIPLLYSSCVDPCLHLTLQFCTPFFVYQITHPSLHWIWLVGDELTEEEQLKVPKGAFFIPFSQFPPRKYRKDCSYQYTPAMLVPSILENVHSCEVCSNNLFFVQWSDMIWLSTLQHGFQPLTVPIKEFAHC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain