|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G56710 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L31e family protein | chr5:22944003-22944767 REVERSE LENGTH=119 | SoyBase | E_val: 1.00E-28 | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
PTHR10956 | Panther | 60S RIBOSOMAL PROTEIN L31 | JGI | ISS | |
PF01198 | PFAM | Ribosomal protein L31e | JGI | ISS | |
UniRef100_G7KIQ1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L31 n=1 Tax=Medicago truncatula RepID=G7KIQ1_MEDTR | SoyBase | E_val: 5.00E-34 | ISS |
UniRef100_I1JMI2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JMI2_SOYBN | SoyBase | E_val: 5.00E-42 | ISS |
Glyma03g24480 not represented in the dataset |
Glyma03g24480 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.03g101900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g24480.1 sequence type=CDS gene model=Glyma03g24480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGGACAAATGATGTGAAAGTGGATATGAAGCTGAACAAGGTTGTGTGGAGCCACGGGATCCGAAGCGTCTCGAGGAGAATTAGGGTTCGCATTGCCCATAAGAGGAACAATGATGAGGATGCAAAGGAAGAGCTTTATTCCCTTGTTATTGTCATCAAAATCGCCAAGGATGAGCTCAAAGGTTTGGGAACCAAGGTTATTGATGATGAAGATTGA
>Glyma03g24480.1 sequence type=predicted peptide gene model=Glyma03g24480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGTNDVKVDMKLNKVVWSHGIRSVSRRIRVRIAHKRNNDEDAKEELYSLVIVIKIAKDELKGLGTKVIDDED*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||