|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G58640 | AT | Annotation by Michelle Graham. TAIR10: Mitogen activated protein kinase kinase kinase-related | chr3:21687153-21692675 REVERSE LENGTH=809 | SoyBase | E_val: 2.00E-18 | ISS |
GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
GO:0006486 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein glycosylation | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
UniRef100_B9SRD1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase, putative n=1 Tax=Ricinus communis RepID=B9SRD1_RICCO | SoyBase | E_val: 1.00E-24 | ISS |
UniRef100_UPI000233C747 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C747 related cluster n=1 Tax=unknown RepID=UPI000233C747 | SoyBase | E_val: 1.00E-29 | ISS |
Glyma03g24310 not represented in the dataset |
Glyma03g24310 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g24310.1 sequence type=CDS gene model=Glyma03g24310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGGAGACACGAGAAGATGCAGGGCCAGCAGAGCAAGGGCCATCTAATGAGACAAGACTCAAGGAACTTTTTGATAGTATTCCTACCTTGGACGAGCTTCATGCTCTGGGTGGAGAGGGTTTTAAGGCTAATATCATTCTTGTGGATTCAAAGAAAGATAAAAAGCTATCCATGTTAAAGAAATTAATTATGGCATTAGTTAGAGGATTAAACTCTAATCCAACTGCCATAATTTAG
>Glyma03g24310.1 sequence type=predicted peptide gene model=Glyma03g24310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEETREDAGPAEQGPSNETRLKELFDSIPTLDELHALGGEGFKANIILVDSKKDKKLSMLKKLIMALVRGLNSNPTAII*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||