Glyma03g23995 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g23995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g23995): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g23995

Feature Type:	gene_model
Chromosome:	Gm03
Start:	30641747
stop:	30644872
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g23995

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G16970	AT	Annotation by Michelle Graham. TAIR10: alkenal reductase \| chr5:5576291-5578001 REVERSE LENGTH=345	SoyBase	E_val: 9.00E-35	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0015824	GO-bp	Annotation by Michelle Graham. GO Biological Process: proline transport	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
GO:0032440	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 2-alkenal reductase [NAD(P)] activity	SoyBase	N/A	ISS
UniRef100_G7ZVT0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Quinone oxidoreductase-like protein n=1 Tax=Medicago truncatula RepID=G7ZVT0_MEDTR	SoyBase	E_val: 1.00E-51	ISS
UniRef100_UPI0002336E8A	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002336E8A related cluster n=1 Tax=unknown RepID=UPI0002336E8A	SoyBase	E_val: 8.00E-76	ISS

Expression Patterns of Glyma03g23995

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g23995 not represented in the dataset	Glyma03g23995 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g23995 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g098500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g23995

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g23995

Limit To All Plant Sequences

>Glyma03g23995.1   sequence type=CDS   gene model=Glyma03g23995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACACAAGTGAGGAACAAGCAAGGGCTTCTAAGGGACTATGCCACTGGTTTTCCCAAAGAATCAGACATGAACGTTGTTGAAAGTGTCATAACTTTAAAGCTTCCTAAAGATTCTAACGAGGACACTACTGACGCAAAATTAGGAGCCTGCACCCCTGGCTTTCCATTAACAGGATATGGTGTGTCTAAAGTCCTAGAATCTGGACACCCAGATTACAAGAATGATTTAGAGTGGGGGATTACTAAATGGGAAGAGTACAGCTTAGTCTCCTCAACTCAAATACTTTTTAAAATTGAGCACACTGATGTCTCACTTTCCTACTATACTGAAATTCTTGGTATAAAGGAAAGTGTTTTCATTTCAGCTACCTCTGGAGCAGTTGGTCAATGA

Predicted protein sequences of Glyma03g23995

Limit To All Plant Sequences

>Glyma03g23995.1   sequence type=predicted peptide   gene model=Glyma03g23995   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTQVRNKQGLLRDYATGFPKESDMNVVESVITLKLPKDSNEDTTDAKLGACTPGFPLTGYGVSKVLESGHPDYKNDLEWGITKWEEYSLVSSTQILFKIEHTDVSLSYYTEILGIKESVFISATSGAVGQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain