SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g23554): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g23554): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g23554

Feature Type:gene_model
Chromosome:Gm03
Start:30102782
stop:30103165
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g23554
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33120AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr4:15975577-15978055 REVERSE LENGTH=355 SoyBaseE_val: 3.00E-55ISS
GO:0008610GO-bp Annotation by Michelle Graham. GO Biological Process: lipid biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0030794GO-mf Annotation by Michelle Graham. GO Molecular Function: (S)-coclaurine-N-methyltransferase activity SoyBaseN/AISS
PTHR10108Panther METHYLTRANSFERASE JGI ISS
PTHR10108:SF301Panther SUBFAMILY NOT NAMED JGI ISS
PF02353PFAM Cyclopropane-fatty-acyl-phospholipid synthase JGI ISS
UniRef100_G7J8C3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclopropane-fatty-acyl-phospholipid synthase n=1 Tax=Medicago truncatula RepID=G7J8C3_MEDTR SoyBaseE_val: 3.00E-63ISS
UniRef100_UPI0002337498UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337498 related cluster n=1 Tax=unknown RepID=UPI0002337498 SoyBaseE_val: 2.00E-81ISS

Expression Patterns of Glyma03g23554
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g23554 not represented in the dataset
Glyma03g23554 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g23554 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g095400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g23554
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g23554
>Glyma03g23554.1   sequence type=CDS   gene model=Glyma03g23554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGAAATTGTGCTGCGAGAGATCAAATTTGAAAGACGGTTATACAGTACTTGATTTGGGATGCGGTTGGGGATCGCTGGTTTTGTACATTGCCAAGAATTACACTAACTGTAGGGTTATTGGAAGCAGCTATTCGACAACTCAAAAGACTTATATTGAGGAGAAGTGCCGAGATCTTCAGCTGCAAAATTTGAATATTATAGTTGCTGATATTGGCACATTTGAAATGGAGGCTTCTTACGACATAATATTTTCCATAGAAATGTTTGAGCATATGAAGAACTATAAAGATCTTCTCAAGAAGATATCCAAATGGATGAAAGAGGATAGCCTTTTATTTGTTCATATCATGTGCCACAAAGCATATCCTTAA
Predicted protein sequences of Glyma03g23554
>Glyma03g23554.1   sequence type=predicted peptide   gene model=Glyma03g23554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKLCCERSNLKDGYTVLDLGCGWGSLVLYIAKNYTNCRVIGSSYSTTQKTYIEEKCRDLQLQNLNIIVADIGTFEMEASYDIIFSIEMFEHMKNYKDLLKKISKWMKEDSLLFVHIMCHKAYP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo