Glyma03g23306 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g23306): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g23306): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g23306

Feature Type:	gene_model
Chromosome:	Gm03
Start:	29875651
stop:	29876746
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g23306

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG01360	AT	Annotation by Michelle Graham. TAIR10: cytochrome oxidase \| chrM:349830-351413 REVERSE LENGTH=527	SoyBase	E_val: 1.00E-42	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0022900	GO-bp	Annotation by Michelle Graham. GO Biological Process: electron transport chain	SoyBase	N/A	ISS
GO:0022904	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory electron transport chain	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005751	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex IV	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0004129	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR10422	Panther	CYTOCHROME OXIDASE SUBUNIT 1	JGI		ISS
PF00115	PFAM	Cytochrome C and Quinol oxidase polypeptide I	JGI		ISS
UniRef100_B4XVW3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase subunit 1 (Fragment) n=1 Tax=Bertiera laxissima RepID=B4XVW3_9GENT	SoyBase	E_val: 3.00E-47	ISS
UniRef100_B4XVW3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Cytochrome c oxidase subunit 1 (Fragment) n=1 Tax=Bertiera laxissima RepID=B4XVW3_9GENT	SoyBase	E_val: 3.00E-47	ISS

Expression Patterns of Glyma03g23306

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g23306 not represented in the dataset	Glyma03g23306 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g23306 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g094400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g23306

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g23306

Limit To All Plant Sequences

>Glyma03g23306.1   sequence type=CDS   gene model=Glyma03g23306   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATTAACCGATCAAAACTTTAATACAACCTTTTCTGATCCCGCAGGAGGGGGAGACCCCATCTTATACCAGCATCTCTTTCGGTTCTTCGGTCATCCAGAGGTGTATATTCCCATTCTGCCTGGATCCGGTATCATGAGTCATATTGTTTTGACTTTTTCGGGAAAACCGGTCTTCGGGTATCTAGGCATGGTTTATGCCATGATCAGTATAGGTGTTCTTGGATTTCTTGTTTGGAGTAAACCAGAAAAATATAGGTAA

Predicted protein sequences of Glyma03g23306

Limit To All Plant Sequences

>Glyma03g23306.1   sequence type=predicted peptide   gene model=Glyma03g23306   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLTDQNFNTTFSDPAGGGDPILYQHLFRFFGHPEVYIPILPGSGIMSHIVLTFSGKPVFGYLGMVYAMISIGVLGFLVWSKPEKYR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain