SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g22945): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g22945): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g22945

Feature Type:gene_model
Chromosome:Gm03
Start:29621473
stop:29622126
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g22945
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29000AT Annotation by Michelle Graham. TAIR10: Heavy metal transport/detoxification superfamily protein | chr1:10113018-10114340 FORWARD LENGTH=287 SoyBaseE_val: 2.00E-20ISS
GO:0030001GO-bp Annotation by Michelle Graham. GO Biological Process: metal ion transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
KOG1603 KOG Copper chaperone JGI ISS
PTHR22814Panther COPPER TRANSPORT PROTEIN ATOX1-RELATED JGI ISS
PTHR22814:SF13Panther COPPER CHAPERONE-RELATED JGI ISS
PF00403PFAM Heavy-metal-associated domain JGI ISS
UniRef100_B9SKJ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metal ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9SKJ8_RICCO SoyBaseE_val: 2.00E-30ISS
UniRef100_UPI0002337492UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337492 related cluster n=1 Tax=unknown RepID=UPI0002337492 SoyBaseE_val: 4.00E-124ISS

Expression Patterns of Glyma03g22945
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g22945 not represented in the dataset
Glyma03g22945 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g22945
ParalogEvidenceComments
Glyma16g08920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g22945 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g093400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g22945
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g22945
>Glyma03g22945.1   sequence type=CDS   gene model=Glyma03g22945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGGTTTCAAGCCAATTATCCGCATAATCTCGGTGAGGGTTCACATGCATTGTGGCAAATGTGAGGCAGACCTAAAAAGTAGATTAATAAAGCACAAAGGTATTTTCAATGTGAAAACCGACCAGAAAGCACAAAATGTAACAGTGGAAGGTACAATTGAAGTGGAGAAATTGATATCATTTTTGAGAAAAAGAGTGCACAAAAATGCTGAGATTATTTCCATAAAGGAAGTGAAAAGGGATCAAGAGAAGAAGGGCAAAGAGGAAGTGCAGTCTTCAGAAACCAGCAAAGAGAAGGATCATAGTAAGTCTGGTGAATCAACCAAGAAAAAAGATGATGATAAAAAAAAAACAGGTGAATCAACCAAGGAAAAAGAAGACGGCAAATCTAGTGAAACAACCAAAATAATGAGTCATCAAGGGCACCCAAAAGAGGAAAATAAGATAAAGGATAATGTTCCTTATATTATTCATTATGTCTACGCGCAACAACTTTTCACAGGTGAGAATCCAAATTCATGTTCTATTTTATAA
Predicted protein sequences of Glyma03g22945
>Glyma03g22945.1   sequence type=predicted peptide   gene model=Glyma03g22945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCGFKPIIRIISVRVHMHCGKCEADLKSRLIKHKGIFNVKTDQKAQNVTVEGTIEVEKLISFLRKRVHKNAEIISIKEVKRDQEKKGKEEVQSSETSKEKDHSKSGESTKKKDDDKKKTGESTKEKEDGKSSETTKIMSHQGHPKEENKIKDNVPYIIHYVYAQQLFTGENPNSCSIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo