SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g22003): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g22003): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g22003

Feature Type:gene_model
Chromosome:Gm03
Start:27937902
stop:27939522
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g22003
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G45600AT Annotation by Michelle Graham. TAIR10: YEATS family protein | chr5:18488059-18489666 FORWARD LENGTH=268 SoyBaseE_val: 7.00E-43ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0048510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase SoyBaseN/AISS
GO:0090239GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of histone H4 acetylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR23195Panther YEATS DOMAIN JGI ISS
PTHR23195:SF15Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7JW72UniRef Annotation by Michelle Graham. Most informative UniRef hit: AF-9-like protein n=1 Tax=Medicago truncatula RepID=G7JW72_MEDTR SoyBaseE_val: 6.00E-48ISS
UniRef100_I1LI12UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI12_SOYBN SoyBaseE_val: 4.00E-55ISS

Expression Patterns of Glyma03g22003
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g22003 not represented in the dataset
Glyma03g22003 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g22003 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g087300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g22003
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g22003
>Glyma03g22003.1   sequence type=CDS   gene model=Glyma03g22003   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCAATTACTAGGCTTATTAAAAATCCAGTTTCCTTCTACAATTAATTATGCATACAATTTGTGGACAATTTATAGGTATCAGCATTTGAAATTATATCCAGAAGATGAATCTAGCCCCCAGTCTATGAAGAAACTCGTGGTTGTTGAATCTTATAACGAGATTGTTTTCCCTGAACCCTCAGAGGTTTTTCTTGCATATGTACAGAATCATCATGTTGTTAATGTGCCTAGACTTCCTGCTGGTTTGAATTTATCAAGTCCTATACCAAGCGATACTGTGAATGATAAGGAGAGAGGTGACAGCAAAGATCATCCTCTAACCCAATGGTTCTTGAACTTCTCTGAGGCTGATGAGCTCTTAAAACTTGCAGCAGCTCGCTAG
Predicted protein sequences of Glyma03g22003
>Glyma03g22003.1   sequence type=predicted peptide   gene model=Glyma03g22003   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWQLLGLLKIQFPSTINYAYNLWTIYRYQHLKLYPEDESSPQSMKKLVVVESYNEIVFPEPSEVFLAYVQNHHVVNVPRLPAGLNLSSPIPSDTVNDKERGDSKDHPLTQWFLNFSEADELLKLAAAR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo