|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G45600 | AT | Annotation by Michelle Graham. TAIR10: YEATS family protein | chr5:18488059-18489666 FORWARD LENGTH=268 | SoyBase | E_val: 7.00E-43 | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0048510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase | SoyBase | N/A | ISS |
| GO:0090239 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of histone H4 acetylation | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| PTHR23195 | Panther | YEATS DOMAIN | JGI | ISS | |
| PTHR23195:SF15 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| UniRef100_G7JW72 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AF-9-like protein n=1 Tax=Medicago truncatula RepID=G7JW72_MEDTR | SoyBase | E_val: 6.00E-48 | ISS |
| UniRef100_I1LI12 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI12_SOYBN | SoyBase | E_val: 4.00E-55 | ISS |
|
Glyma03g22003 not represented in the dataset |
Glyma03g22003 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g087300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g22003.1 sequence type=CDS gene model=Glyma03g22003 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGGCAATTACTAGGCTTATTAAAAATCCAGTTTCCTTCTACAATTAATTATGCATACAATTTGTGGACAATTTATAGGTATCAGCATTTGAAATTATATCCAGAAGATGAATCTAGCCCCCAGTCTATGAAGAAACTCGTGGTTGTTGAATCTTATAACGAGATTGTTTTCCCTGAACCCTCAGAGGTTTTTCTTGCATATGTACAGAATCATCATGTTGTTAATGTGCCTAGACTTCCTGCTGGTTTGAATTTATCAAGTCCTATACCAAGCGATACTGTGAATGATAAGGAGAGAGGTGACAGCAAAGATCATCCTCTAACCCAATGGTTCTTGAACTTCTCTGAGGCTGATGAGCTCTTAAAACTTGCAGCAGCTCGCTAG
>Glyma03g22003.1 sequence type=predicted peptide gene model=Glyma03g22003 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MWQLLGLLKIQFPSTINYAYNLWTIYRYQHLKLYPEDESSPQSMKKLVVVESYNEIVFPEPSEVFLAYVQNHHVVNVPRLPAGLNLSSPIPSDTVNDKERGDSKDHPLTQWFLNFSEADELLKLAAAR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||