SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g21956): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g21956): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g21956

Feature Type:gene_model
Chromosome:Gm03
Start:27910772
stop:27911756
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75460AT Annotation by Michelle Graham. TAIR10: ATP-dependent protease La (LON) domain protein | chr1:28327986-28328822 FORWARD LENGTH=278 SoyBaseE_val: 3.00E-35ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004176GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity SoyBaseN/AISS
PTHR23327Panther UNCHARACTERIZED JGI ISS
PF02190PFAM ATP-dependent protease La (LON) domain JGI ISS
UniRef100_E6NU58UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL18I08.2 protein n=1 Tax=Jatropha curcas RepID=E6NU58_9ROSI SoyBaseE_val: 2.00E-36ISS
UniRef100_I1JM75UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JM75_SOYBN SoyBaseE_val: 9.00E-67ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g21956 not represented in the dataset

Glyma03g21956 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g087200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g21956.1   sequence type=CDS   gene model=Glyma03g21956   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCGGCGTCGTCGGAGAAGCAGCCCCCAACGATGCACTGGAGCTCGCTCTCTTCCCTCTCCCTTTGGTCCTCTTCCCCGGTGCGATCCTCCCCCTCCAGATCTTCGAGTTCCGCTACCGCATCATGATGCATAGGCTCCTTCATACCAACCTCTGCTTCGGCGTCATCTACAACAACGCCATCTCGGGCACTGCTGAGGTCAGCTGCGTGGGCGAGGTCATCAAACACGAGCGCCTCGTCGACAATAGGTTCTTCTTAGTGTGCAAGGGGCAAGAGCGGTTCCGCGTGAACGATGTCTGGAAAAAGGAGAAAGCGACATTTAAAAATGGTGTTTCAACCACTGTCGTTGTTGAAGAACACGATAATTACAAAAATGCCACCGATAAAGTAACAGCGACAGATGTTTTTTACACCGATGTAGAACCTACTTCATAA

>Glyma03g21956.1   sequence type=predicted peptide   gene model=Glyma03g21956   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGVVGEAAPNDALELALFPLPLVLFPGAILPLQIFEFRYRIMMHRLLHTNLCFGVIYNNAISGTAEVSCVGEVIKHERLVDNRFFLVCKGQERFRVNDVWKKEKATFKNGVSTTVVVEEHDNYKNATDKVTATDVFYTDVEPTS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo