|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G75460 | AT | Annotation by Michelle Graham. TAIR10: ATP-dependent protease La (LON) domain protein | chr1:28327986-28328822 FORWARD LENGTH=278 | SoyBase | E_val: 3.00E-35 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0009617 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to bacterium | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0035304 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0004176 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity | SoyBase | N/A | ISS |
| PTHR23327 | Panther | UNCHARACTERIZED | JGI | ISS | |
| PF02190 | PFAM | ATP-dependent protease La (LON) domain | JGI | ISS | |
| UniRef100_E6NU58 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: JHL18I08.2 protein n=1 Tax=Jatropha curcas RepID=E6NU58_9ROSI | SoyBase | E_val: 2.00E-36 | ISS |
| UniRef100_I1JM75 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JM75_SOYBN | SoyBase | E_val: 9.00E-67 | ISS |
|
Glyma03g21956 not represented in the dataset |
Glyma03g21956 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g087200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g21956.1 sequence type=CDS gene model=Glyma03g21956 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTCGGCGTCGTCGGAGAAGCAGCCCCCAACGATGCACTGGAGCTCGCTCTCTTCCCTCTCCCTTTGGTCCTCTTCCCCGGTGCGATCCTCCCCCTCCAGATCTTCGAGTTCCGCTACCGCATCATGATGCATAGGCTCCTTCATACCAACCTCTGCTTCGGCGTCATCTACAACAACGCCATCTCGGGCACTGCTGAGGTCAGCTGCGTGGGCGAGGTCATCAAACACGAGCGCCTCGTCGACAATAGGTTCTTCTTAGTGTGCAAGGGGCAAGAGCGGTTCCGCGTGAACGATGTCTGGAAAAAGGAGAAAGCGACATTTAAAAATGGTGTTTCAACCACTGTCGTTGTTGAAGAACACGATAATTACAAAAATGCCACCGATAAAGTAACAGCGACAGATGTTTTTTACACCGATGTAGAACCTACTTCATAA
>Glyma03g21956.1 sequence type=predicted peptide gene model=Glyma03g21956 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLGVVGEAAPNDALELALFPLPLVLFPGAILPLQIFEFRYRIMMHRLLHTNLCFGVIYNNAISGTAEVSCVGEVIKHERLVDNRFFLVCKGQERFRVNDVWKKEKATFKNGVSTTVVVEEHDNYKNATDKVTATDVFYTDVEPTS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||