Glyma03g21575 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g21575): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g21575): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g21575

Feature Type:	gene_model
Chromosome:	Gm03
Start:	27136889
stop:	27137295
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g21575

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17380	AT	Annotation by Michelle Graham. TAIR10: Thiamine pyrophosphate dependent pyruvate decarboxylase family protein \| chr5:5724920-5726720 REVERSE LENGTH=572	SoyBase	E_val: 3.00E-36	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0046482	GO-bp	Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004737	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyruvate decarboxylase activity	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
GO:0030976	GO-mf	Annotation by Michelle Graham. GO Molecular Function: thiamine pyrophosphate binding	SoyBase	N/A	ISS
PTHR18968	Panther	THIAMINE PYROPHOSPHATE ENZYMES	JGI		ISS
PTHR18968:SF6	Panther	gb def: 2-oxoglutarate decarboxylase and 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carbo	JGI		ISS
UniRef100_D2D327	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pyruvate decarboxylase n=1 Tax=Gossypium hirsutum RepID=D2D327_GOSHI	SoyBase	E_val: 7.00E-37	ISS
UniRef100_I1MBN8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MBN8_SOYBN	SoyBase	E_val: 5.00E-40	ISS

Expression Patterns of Glyma03g21575

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g21575 not represented in the dataset	Glyma03g21575 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g21575 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g085600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g21575

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g21575

Limit To All Plant Sequences

>Glyma03g21575.1   sequence type=CDS   gene model=Glyma03g21575   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCCATATACGTTGGTTTGGTACCAGCTGCCTGTGGTCGTGATTGTTTTCAACAATAGTGGTGTATATGGTGATGACCATTTTGTCCCAAATGCAAGGTACCATGCTTTGATAGAAGCTTTTGGTGGAAAGGGCTATCTTGTTGGGACGCCTGATGAACTCAAGTCTGCCCTTTCAAAATCCTTCTCTGCTAGGAAACCAGCTGTAGTAAATGTTGTGATCGATTCCTATGCTAGTTCAGAGAGTGGAAGGATGCAACATAAGAATTGA

Predicted protein sequences of Glyma03g21575

Limit To All Plant Sequences

>Glyma03g21575.1   sequence type=predicted peptide   gene model=Glyma03g21575   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVPYTLVWYQLPVVVIVFNNSGVYGDDHFVPNARYHALIEAFGGKGYLVGTPDELKSALSKSFSARKPAVVNVVIDSYASSESGRMQHKN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain