Glyma03g19850 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g19850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g19850): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g19850

Feature Type:	gene_model
Chromosome:	Gm03
Start:	25242750
stop:	25243283
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g19850

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G33820	AT	Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein \| chr2:14306293-14308293 REVERSE LENGTH=311	SoyBase	E_val: 6.00E-38	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006839	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0000064	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-ornithine transmembrane transporter activity	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005290	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-histidine transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015181	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arginine transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015189	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-lysine transmembrane transporter activity	SoyBase	N/A	ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF54	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_B9RBB5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial carnitine/acylcarnitine carrier protein, putative n=1 Tax=Ricinus communis RepID=B9RBB5_RICCO	SoyBase	E_val: 1.00E-45	ISS
UniRef100_I1KLM9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLM9_SOYBN	SoyBase	E_val: 7.00E-62	ISS

Expression Patterns of Glyma03g19850

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g19850 not represented in the dataset	Glyma03g19850 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g19850 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g19850

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g19850

Limit To All Plant Sequences

>Glyma03g19850.1   sequence type=CDS   gene model=Glyma03g19850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAATCTATAGGGAATGCTGTCTTTTTCAGTGTATACGAATATGTGCGTTATTACATGCATTCAAATATCAAAGCTGCTTCATCCAATTACACCAACCTAGTTGATATTGGAATTGGGATCGTTAGTGGTGGCCTTGGTGGTGTGGCTTTTTGGTTGACAGTTTTTCCTCTTGATGTGGCAAAAACTTTAATTCAGACAAACCCTGATAAAAATTGTCCAAGAAATCCTTTTTGGGTCTTGAGTTCAGGATGCTATACAGGTTTGGGTCCTACTGTAAGTCGAGCATTTCCTGCTAATGCTGCAACAATT

Predicted protein sequences of Glyma03g19850

Limit To All Plant Sequences

>Glyma03g19850.1   sequence type=predicted peptide   gene model=Glyma03g19850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ESIGNAVFFSVYEYVRYYMHSNIKAASSNYTNLVDIGIGIVSGGLGGVAFWLTVFPLDVAKTLIQTNPDKNCPRNPFWVLSSGCYTGLGPTVSRAFPANAATI

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain