|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G46560 | AT | Annotation by Michelle Graham. TAIR10: Tim10/DDP family zinc finger protein | chr3:17138632-17139301 FORWARD LENGTH=93 | SoyBase | E_val: 1.00E-40 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006626 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009853 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photorespiration | SoyBase | N/A | ISS |
| GO:0045039 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005743 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane | SoyBase | N/A | ISS |
| GO:0005758 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space | SoyBase | N/A | ISS |
| GO:0042719 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space protein transporter complex | SoyBase | N/A | ISS |
| GO:0015450 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity | SoyBase | N/A | ISS |
| KOG3479 | KOG | Mitochondrial import inner membrane translocase, subunit TIM9 | JGI | ISS | |
| PTHR10898 | Panther | MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9 | JGI | ISS | |
| PF02953 | PFAM | Tim10/DDP family zinc finger | JGI | ISS | |
| UniRef100_I1JM38 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JM38_SOYBN | SoyBase | E_val: 5.00E-62 | ISS |
| UniRef100_Q9XGX8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit Tim9 n=1 Tax=Mesembryanthemum crystallinum RepID=TIM9_MESCR | SoyBase | E_val: 4.00E-42 | ISS |
|
Glyma03g19460 not represented in the dataset |
Glyma03g19460 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g082300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g19460.1 sequence type=CDS gene model=Glyma03g19460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATAAGAACATAATATCAGACTTGGATAATTTTCCTGAAGAAGATAAGCAAAGAATGTCCACCATGGCAGACCAGCTCCAAATCCGGGACAGTCTAAGGATGTATAATTCATTAGTGGAGAAATGTTTCAAGGAATGTGTCAATACATTCTATCGGAAATCCATGACCAAGCAAGAAGAAACTTGTGTTCTCAGATGTGCTCAAAAGTACTTGAGGCTTTCAATGCAAGTTGGCTTGAGATTTTCAGATCTCAACCAAGGATCATCTACAACAGATAAATAG
>Glyma03g19460.1 sequence type=predicted peptide gene model=Glyma03g19460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDKNIISDLDNFPEEDKQRMSTMADQLQIRDSLRMYNSLVEKCFKECVNTFYRKSMTKQEETCVLRCAQKYLRLSMQVGLRFSDLNQGSSTTDK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||