SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g19260

Feature Type:gene_model
Chromosome:Gm03
Start:24587820
stop:24589316
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
PF01439PFAM Metallothionein JGI ISS
UniRef100_D3YBH7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Metallothionein type 1 n=2 Tax=Phaseoleae RepID=D3YBH7_CAJCA SoyBaseE_val: 1.00E-34ISS
UniRef100_I1JM37UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JM37_SOYBN SoyBaseE_val: 1.00E-42ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g082100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g19260.1   sequence type=CDS   gene model=Glyma03g19260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAGCTGTGGGTGTGGAAGCAGCTGCAACTGTGGCAGCAACTGCAGTTGCAACAAGTACTCTTTTGACTACGTTGAGAAGATCACAAATGAGACTCTAGTTTTGGGTGTTGGGCCGGTGAAGGCCCAATTCGAGGGTGCTGAAATGGGTGTTGCAGCTGAGAACGGTGGCTGCAACTGTGGATCAAACTGCACTTGCGACCCATGCAGCTGCAAGTGA

>Glyma03g19260.1   sequence type=predicted peptide   gene model=Glyma03g19260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSCGCGSSCNCGSNCSCNKYSFDYVEKITNETLVLGVGPVKAQFEGAEMGVAAENGGCNCGSNCTCDPCSCK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo