SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G02030 | AT | Annotation by Michelle Graham. TAIR10: POX (plant homeobox) family protein | chr5:395754-398872 FORWARD LENGTH=575 | SoyBase | E_val: 1.00E-105 | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0007267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell-cell signaling | SoyBase | N/A | ISS |
| GO:0007389 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pattern specification process | SoyBase | N/A | ISS |
| GO:0009616 | GO-bp | Annotation by Michelle Graham. GO Biological Process: virus induced gene silencing | SoyBase | N/A | ISS |
| GO:0009855 | GO-bp | Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry | SoyBase | N/A | ISS |
| GO:0009886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis | SoyBase | N/A | ISS |
| GO:0009887 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ morphogenesis | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009944 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis | SoyBase | N/A | ISS |
| GO:0010014 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem initiation | SoyBase | N/A | ISS |
| GO:0010051 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation | SoyBase | N/A | ISS |
| GO:0010076 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity | SoyBase | N/A | ISS |
| GO:0010077 | GO-bp | Annotation by Michelle Graham. GO Biological Process: maintenance of inflorescence meristem identity | SoyBase | N/A | ISS |
| GO:0010154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: fruit development | SoyBase | N/A | ISS |
| GO:0010223 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary shoot formation | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of ta-siRNAs involved in RNA interference | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0035196 | GO-bp | Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA | SoyBase | N/A | ISS |
| GO:0045892 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048367 | GO-bp | Annotation by Michelle Graham. GO Biological Process: shoot development | SoyBase | N/A | ISS |
| GO:0048438 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral whorl development | SoyBase | N/A | ISS |
| GO:0048439 | GO-bp | Annotation by Michelle Graham. GO Biological Process: flower morphogenesis | SoyBase | N/A | ISS |
| GO:0048457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: floral whorl morphogenesis | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0048507 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem development | SoyBase | N/A | ISS |
| GO:0048513 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ development | SoyBase | N/A | ISS |
| GO:0048519 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process | SoyBase | N/A | ISS |
| GO:0048645 | GO-bp | Annotation by Michelle Graham. GO Biological Process: organ formation | SoyBase | N/A | ISS |
| GO:0080006 | GO-bp | Annotation by Michelle Graham. GO Biological Process: internode patterning | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0043565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding | SoyBase | N/A | ISS |
| KOG0773 | KOG | Transcription factor MEIS1 and related HOX domain proteins | JGI | ISS | |
| PTHR11850 | Panther | HOMEOBOX PROTEIN | JGI | ISS | |
| PTHR11850:SF51 | Panther | PRE-B-CELL LEUKEMIA TRANSCRIPTION FACTOR 1 | JGI | ISS | |
| PF00046 | PFAM | Homeobox domain | JGI | ISS | |
| PF07526 | PFAM | Associated with HOX | JGI | ISS | |
| UniRef100_B9SV36 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Bel1 homeotic protein, putative n=1 Tax=Ricinus communis RepID=B9SV36_RICCO | SoyBase | E_val: 0 | ISS |
| UniRef100_I1JM11 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JM11_SOYBN | SoyBase | E_val: 0 | ISS |
|
Glyma03g17397 not represented in the dataset |
Glyma03g17397 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma01g25710 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g070900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g17397.1 sequence type=CDS gene model=Glyma03g17397 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGTTTAAGCCTGAGCCTTTGTCTTTGTCTCTGTCATCACACAACAACGGTGTGAATCTTCAGCGATACGGATCTGTGGTTTATGGTGATAAGGTTGGTGGTGGTGGGGTGATTTATGGGAGTTCTGGTTTGAATGAGGTTTCGAGGTGCACAGTGCCAATGGGGCCATTTACTGGCTATGCTTCAATATTGAAGGGATCGAGGTTCTTGAAGCCTGCACAGCAATTATTGGAAGAGTTATGTGATGTTGGTGGGGTTTGTGCTGAGAAGATTGTGGCTGATGCATCGTTGATGGAGCCTATTCCTCCTCCACAGAGTTCAAGTGAAGATCCACTAGGGGATCATGGGGGTGATCAAGGTCGCAAAAAGTCAAGGCTCTTAACTATGCTTGATGAGGTTTACAGGAGGTACAGACAATACTATCAGCAGATGCACGCGGTAGTAACTTCATTTGAGTATGTCTCTGGCCTGAGCAATGCAGCTCCTTATGCAAGTTTGGCTATAAAAGCCATGTCCAAACATTTTAGATGCTTGAAGAATGCCATTACTGATCAACTTCAGTTTGCCAATAAAGCTCATTTTCACATCAGCAATAACAGGAAAGATGAATCTCCATGGTTTGGCAACAGTGATAAAGGCCCTTATGGCCAAAGGCCTGGGTTTCTTGAGCACCAACCTGTTTGGCGGCCTCAAAGAGGACTCCCTGAGCGCGCCGTGACTGTTCTGAGAGCTTGGTTGTTTGAGCACTTTCTGCACCCTTATCCCACTGATACCGACAAGCTAATGTTGGCCAAACAAACTGGTCTATCTCGTAGCCAGGTGTCTAATTGGTTCATTAATGCAAGAGTAAGGCTCTGGAAGCCAATGGTGGAAGAAATACATTTGCTAGAAACACGGCAAGCTCCAAAGAATCCGCAGAAGGAAGAGCATTGCAGGAACAAGCTAAGTGATCATTTGTCTTCTGATAACTCCATTGTTTCTGAGAATCCATCTACCTCCACAGATAAATTTCAGGAAGCTCCTTACAAGCACACCATAAACGAACTTCCTAATGTACCAATTAGGACTCAGGAACAGCTGAATCTACCCTGCACAAGCAATCAGCCAGGAGGAGGGGGTGTTGGAGTGAGCATGGGTGGTGGCAGTGCTAGCAATAGTGTGTCACTCACACTAGGCCTTTATCAGAATCATGGTATTGGTCTGGCTGAACCTTTCCCCTTGAATGCAGCGCAGCGATTTGGTGTTGCTCTTGATACCAACAATGAAGGCTATGTTATGAGTGGTTATGAGTCACAAAATAGGCATTTTGGAAGAGATGTCATTGGAGGACAACTGTTGCATGACTTTGTAGGCTGA
>Glyma03g17397.1 sequence type=predicted peptide gene model=Glyma03g17397 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVFKPEPLSLSLSSHNNGVNLQRYGSVVYGDKVGGGGVIYGSSGLNEVSRCTVPMGPFTGYASILKGSRFLKPAQQLLEELCDVGGVCAEKIVADASLMEPIPPPQSSSEDPLGDHGGDQGRKKSRLLTMLDEVYRRYRQYYQQMHAVVTSFEYVSGLSNAAPYASLAIKAMSKHFRCLKNAITDQLQFANKAHFHISNNRKDESPWFGNSDKGPYGQRPGFLEHQPVWRPQRGLPERAVTVLRAWLFEHFLHPYPTDTDKLMLAKQTGLSRSQVSNWFINARVRLWKPMVEEIHLLETRQAPKNPQKEEHCRNKLSDHLSSDNSIVSENPSTSTDKFQEAPYKHTINELPNVPIRTQEQLNLPCTSNQPGGGGVGVSMGGGSASNSVSLTLGLYQNHGIGLAEPFPLNAAQRFGVALDTNNEGYVMSGYESQNRHFGRDVIGGQLLHDFVG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
