Glyma03g17360 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g17360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g17360): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g17360

Feature Type:	gene_model
Chromosome:	Gm03
Start:	22004995
stop:	22005276
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g17360

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26500	AT	Annotation by Michelle Graham. TAIR10: cytochrome b6f complex subunit (petM), putative \| chr2:11270370-11270747 FORWARD LENGTH=125	SoyBase	E_val: 3.00E-28	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009512	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009496	GO-mf	Annotation by Michelle Graham. GO Molecular Function: plastoquinol--plastocyanin reductase activity	SoyBase	N/A	ISS
PF08041	PFAM	PetM family of cytochrome b6f complex subunit 7	JGI		ISS
UniRef100_B9R7K1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plastoquinol-plastocyanin reductase, putative n=1 Tax=Ricinus communis RepID=B9R7K1_RICCO	SoyBase	E_val: 2.00E-31	ISS
UniRef100_I1JM10	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JM10_SOYBN	SoyBase	E_val: 2.00E-51	ISS

Expression Patterns of Glyma03g17360

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g17360 not represented in the dataset	Glyma03g17360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g17360 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g071200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g17360

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g17360

Limit To All Plant Sequences

>Glyma03g17360.2   sequence type=CDS   gene model=Glyma03g17360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTGTGCTATCATTTGGGGGACTGAAGGCTAGCAATGGTGTTGTCTCTTTGGGGTTTCCTATGAGCACTGAGAAGTGCTTTGCTAAGGTTGTGAGTTCAGTGAAAACAACAACATCAAATGGAAAAGGAAAGAGTGGAGGGGCACTCTCCTCCACGTGCAACGCTGTAAGTAAGATATTCATGATTGCTACTATCATCAATGGACTTGTTCTTGTTGGGGTTGTAGTTGGGTTTGTGCTCCTGCGAGTTGAAGCATGGGTCAAGGAGTTTGAGGCAAAATGA

Predicted protein sequences of Glyma03g17360

Limit To All Plant Sequences

>Glyma03g17360.2   sequence type=predicted peptide   gene model=Glyma03g17360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GVLSFGGLKASNGVVSLGFPMSTEKCFAKVVSSVKTTTSNGKGKSGGALSSTCNAVSKIFMIATIINGLVLVGVVVGFVLLRVEAWVKEFEAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain