Glyma03g17020 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g17020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g17020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g17020

Feature Type:	gene_model
Chromosome:	Gm03
Start:	21639407
stop:	21641339
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g17020

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G08850	AT	Annotation by Michelle Graham. TAIR10: HEAT repeat ;WD domain, G-beta repeat protein protein \| chr3:2686978-2694911 REVERSE LENGTH=1344	SoyBase	E_val: 6.00E-39	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0007062	GO-bp	Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009880	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification	SoyBase	N/A	ISS
GO:0010072	GO-bp	Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0010431	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed maturation	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0045595	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation	SoyBase	N/A	ISS
GO:0051301	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell division	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR12848	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR12848:SF5	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_B9T6F8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Regulatory-associated protein of mTOR, putative n=3 Tax=Ricinus communis RepID=B9T6F8_RICCO	SoyBase	E_val: 4.00E-44	ISS
UniRef100_I1N356	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N356_SOYBN	SoyBase	E_val: 4.00E-44	ISS

Expression Patterns of Glyma03g17020

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g17020 not represented in the dataset	Glyma03g17020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g17020 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g072000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g17020

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g17020

Limit To All Plant Sequences

>Glyma03g17020.1   sequence type=CDS   gene model=Glyma03g17020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATAAAATGGGACAAATTTGCATACAAAAATAGCAATGACAATTGGCAGAAGCACTTCCTGCAAGCCATGAATGGTCCTTCAATCAATGATTCAAATGGAAAACAAAGTTCTATGGTTCTGATGAATGTTGTTGCTGTTAGTCTTTGTATTGCCCAATTTGGAATTTTGTTAGCTAATGTTCTTTGGAGAATTTCTAAGCTCTGCCTTGTAAATGAGCTTGATGATAGCTTGCTTCTTGATGCTTCATTTGATGGAAACATTCAGATTTGGAAGGACTATCTCCTGAAGGGTAAACAAAAACTTGTCATTGCATTCTCTTCAATTCATGCACATAAACCAGGTGTGAGGAGTCTGAGTGCAGTTGTTGATTGGCAACAACAATGTGATTATCCATATGCATCGGGTGAGATATCATCTATTATGCTATGGGATGTTGATAAAGAGCAGCTTGTTAATTCTAAATCTTCATCATCAGATTGCAACTATGGTACACCAGGGGATGCCCTAGCTACTAAATTTGGATGGCTTGCAGTACTAGGCCTTGCAGTCTATCTACATCATATCCCTTATGATAATAAAATTGTTGAATGTAGCCCTTACGTCATGTGGTTTCTCCGTTATTCATGCATTTTGGTTTCAAATGTAGACAACTCAATTATACAAGTTAATAAGAAAGCCAACTTTCAATTAGGTAGGTTGAAGAAATATATTGTTAACATACACCAAAAAGAATGA

Predicted protein sequences of Glyma03g17020

Limit To All Plant Sequences

>Glyma03g17020.1   sequence type=predicted peptide   gene model=Glyma03g17020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIKWDKFAYKNSNDNWQKHFLQAMNGPSINDSNGKQSSMVLMNVVAVSLCIAQFGILLANVLWRISKLCLVNELDDSLLLDASFDGNIQIWKDYLLKGKQKLVIAFSSIHAHKPGVRSLSAVVDWQQQCDYPYASGEISSIMLWDVDKEQLVNSKSSSSDCNYGTPGDALATKFGWLAVLGLAVYLHHIPYDNKIVECSPYVMWFLRYSCILVSNVDNSIIQVNKKANFQLGRLKKYIVNIHQKE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain