|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G68890 | AT | Annotation by Michelle Graham. TAIR10: magnesium ion binding;thiamin pyrophosphate binding;hydro-lyases;catalytics;2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthases | chr1:25896988-25906553 FORWARD LENGTH=1715 | SoyBase | E_val: 3.00E-15 | ISS |
| GO:0009063 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid catabolic process | SoyBase | N/A | ISS |
| GO:0009234 | GO-bp | Annotation by Michelle Graham. GO Biological Process: menaquinone biosynthetic process | SoyBase | N/A | ISS |
| GO:0042372 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process | SoyBase | N/A | ISS |
| GO:0042550 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem I stabilization | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0000287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0016836 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydro-lyase activity | SoyBase | N/A | ISS |
| GO:0030976 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: thiamine pyrophosphate binding | SoyBase | N/A | ISS |
| GO:0070204 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase activity | SoyBase | N/A | ISS |
| UniRef100_B9RLD6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Menaquinone biosynthesis protein, putative n=1 Tax=Ricinus communis RepID=B9RLD6_RICCO | SoyBase | E_val: 9.00E-16 | ISS |
| UniRef100_UPI00023373D5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00023373D5 related cluster n=1 Tax=unknown RepID=UPI00023373D5 | SoyBase | E_val: 1.00E-55 | ISS |
|
Glyma03g164 not represented in the dataset |
Glyma03g164 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g000400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g164.1 sequence type=CDS gene model=Glyma03g164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGTGTAGCACAACATGAGCAAATGGACTGTATGGTTGAGATTGAGAGTTCCATTAATGCCAATGCCAATTTCCACATTCAAGGCTCTATAAAGGACAAGTTTTGTTTATACAAAATCCGTGAAATACAGTGTTCTAAATATAGAATTGCACTTGAAGCTCCGCCAACATCAACATTTGTTAGTGATAGTTGTAAGGAATTCTATAGAGAAGGATTTATTTTATCTTTAGTGCTTGAAGAGGGAAGTGTTGGTTATGGTGAGGTTGGTATCAGTTTCATGTTATATCATGTCTTGTATCTTGCTTTACATTAA
>Glyma03g164.1 sequence type=predicted peptide gene model=Glyma03g164 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MCVAQHEQMDCMVEIESSINANANFHIQGSIKDKFCLYKIREIQCSKYRIALEAPPTSTFVSDSCKEFYREGFILSLVLEEGSVGYGEVGISFMLYHVLYLALH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||