Glyma03g16296 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g16296): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g16296): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g16296

Feature Type:	gene_model
Chromosome:	Gm03
Start:	20696056
stop:	20698685
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g16296

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G22400	AT	Annotation by Michelle Graham. TAIR10: UDP-Glycosyltransferase superfamily protein \| chr1:7903851-7906607 REVERSE LENGTH=489	SoyBase	E_val: 1.00E-54	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0015020	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glucuronosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016758	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups	SoyBase	N/A	ISS
GO:0050403	GO-mf	Annotation by Michelle Graham. GO Molecular Function: trans-zeatin O-beta-D-glucosyltransferase activity	SoyBase	N/A	ISS
GO:0050502	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cis-zeatin O-beta-D-glucosyltransferase activity	SoyBase	N/A	ISS
PTHR11926	Panther	GLUCOSYL/GLUCURONOSYL TRANSFERASES	JGI		ISS
PTHR11926:SF15	Panther	UDP-GLUCURONOSYLTRANSFERASE RELATED	JGI		ISS
PF00201	PFAM	UDP-glucoronosyl and UDP-glucosyl transferase	JGI		ISS
UniRef100_F8WKW5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: UDP-glucose glucosyltransferase n=1 Tax=Gardenia jasminoides RepID=F8WKW5_9GENT	SoyBase	E_val: 2.00E-67	ISS
UniRef100_UPI000233A4EA	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A4EA related cluster n=1 Tax=unknown RepID=UPI000233A4EA	SoyBase	E_val: 3.00E-137	ISS

Expression Patterns of Glyma03g16296

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g16296 not represented in the dataset	Glyma03g16296 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g16296 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g033100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g16296

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g16296

Limit To All Plant Sequences

>Glyma03g16296.1   sequence type=CDS   gene model=Glyma03g16296   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTTCCAGAAGTCCTCATACGCTTGTTCGACTCGATCAAGCCAAGGCAGTCAATACCTTTGACCAGCTAGAAGCCTCCATTATCACTAAGCTAACTACTATATTCCCCAAGGTATACACCATTGGTCCTCTCCACACTCTCACCAAGACCCAATTCATCACAAACAATAGTTCATCATCCCTTCATTTGAGAAAAGAAGACAAAAGTTGCATAACTTGGCTTGACCAACAAAAGGCAAAGTCAGTTTTATATGTTAGTTTTGGCACCTTGGCAAAGGTGTCACATGAGCAACTATTAGAGATTTGGCATGGTTTGGTGGGTAGTTTGAAGCCTTTCTTGTGGGTTATTAGACAAGGGCTTATCATTGGAGAAGGTGGTTTGGGACATAATGTGCCTATGGAGCTTGAATTGAAGACCAAAGAAAGAGGGCTCATGGTGAATTGGGCCCCTCAAGAAGAGGTTCTGGCCCACCCTTTAGTGGGTGGATTTTTTACTCATAGTGGTTGGAATTCCACATTGGAATGTATTACTGAAGGCGTGCCTATGCTTTGTTGGCCACTGATAGCTGATCAAACGGTTAATAGTAGGTGTGTGAGTGAGCAATGGGGGATTGGGCTTGATATGATGGAATATGTGATAGGCTAA

Predicted protein sequences of Glyma03g16296

Limit To All Plant Sequences

>Glyma03g16296.1   sequence type=predicted peptide   gene model=Glyma03g16296   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSRSPHTLVRLDQAKAVNTFDQLEASIITKLTTIFPKVYTIGPLHTLTKTQFITNNSSSSLHLRKEDKSCITWLDQQKAKSVLYVSFGTLAKVSHEQLLEIWHGLVGSLKPFLWVIRQGLIIGEGGLGHNVPMELELKTKERGLMVNWAPQEEVLAHPLVGGFFTHSGWNSTLECITEGVPMLCWPLIADQTVNSRCVSEQWGIGLDMMEYVIG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain