SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g15680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g15680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g15680

Feature Type:gene_model
Chromosome:Gm03
Start:19685439
stop:19685931
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g15680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32390AT Annotation by Michelle Graham. TAIR10: Nucleotide-sugar transporter family protein | chr4:15636550-15637602 FORWARD LENGTH=350 SoyBaseE_val: 4.00E-67ISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008514GO-mf Annotation by Michelle Graham. GO Molecular Function: organic anion transmembrane transporter activity SoyBaseN/AISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
UniRef100_G7JCY0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Solute carrier family 35 member C2 n=2 Tax=Medicago truncatula RepID=G7JCY0_MEDTR SoyBaseE_val: 2.00E-74ISS
UniRef100_UPI000233A4DFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A4DF related cluster n=1 Tax=unknown RepID=UPI000233A4DF SoyBaseE_val: 4.00E-94ISS

Expression Patterns of Glyma03g15680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g15680 not represented in the dataset
Glyma03g15680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g15680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g073800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g15680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g15680
>Glyma03g15680.1   sequence type=CDS   gene model=Glyma03g15680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTCTCTGACGGCATCACGAAGAAAATCGTCCTCTCCTACACTTACGTGGCGATATGGATCTTCCTCAGCTTCACGGTCATCGAGTACAACAAGTATCGCAAGATGTATAGCTGGCCCTACCCGATCTCTCTCACCATGATCCACATGGTGTTCTGTTCCTCCCTGGCGTACATTCTCATTTGCATCTTGAAGCTCATGGAAGCGGTTTCGATGTCTCAGGATCTCGACCTCAAATCCATTATTCCAATCGATGCATTCTATTCACTTTCCCTCTGGTTTTCCAATTCCGCGTATATATACCTCTCTATTTCGTTCATTCAGATGCTCAAGGCACTTATGCCTCACGAGACCACGGCGAACATGGTTTCCATCACGCTCGGTGTTGCAGTTGCGACTTACAATGAAGCCAAATTCGATGCATGGGGTGTTACCCTATAG
Predicted protein sequences of Glyma03g15680
>Glyma03g15680.1   sequence type=predicted peptide   gene model=Glyma03g15680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVSDGITKKIVLSYTYVAIWIFLSFTVIEYNKYRKMYSWPYPISLTMIHMVFCSSLAYILICILKLMEAVSMSQDLDLKSIIPIDAFYSLSLWFSNSAYIYLSISFIQMLKALMPHETTANMVSITLGVAVATYNEAKFDAWGVTL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo