Glyma03g15560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g15560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g15560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g15560

Feature Type:	gene_model
Chromosome:	Gm03
Start:	19664877
stop:	19665245
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g15560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G62420	AT	Annotation by Michelle Graham. TAIR10: basic region/leucine zipper motif 53 \| chr3:23091844-23092284 REVERSE LENGTH=146	SoyBase	E_val: 6.00E-22	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0009267	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to starvation	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:2000693	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of seed maturation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
GO:0046982	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity	SoyBase	N/A	ISS
PTHR22952	Panther	CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED	JGI		ISS
PTHR22952:SF61	Panther	ATBZIP53 (BASIC REGION/LEUCINE ZIPPER MOTIF 53), D	JGI		ISS
PF00170	PFAM	bZIP transcription factor	JGI		ISS
UniRef100_I1JLV5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLV5_SOYBN	SoyBase	E_val: 2.00E-74	ISS
UniRef100_Q0GPF1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP41 n=1 Tax=Glycine max RepID=Q0GPF1_SOYBN	SoyBase	E_val: 2.00E-37	ISS

Expression Patterns of Glyma03g15560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g15560 not represented in the dataset	Glyma03g15560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g15560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g073900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g15560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g15560

Limit To All Plant Sequences

>Glyma03g15560.1   sequence type=CDS   gene model=Glyma03g15560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTCAAGTCAAAGTTTGGTGAAATCTGATTACGAAGGAGGTGATCCACCACAAATGGACGAGACGAATATGAAGAGGAGGGCATTGAACCGTGAATATGCAAGACAATCGCGGTTGAGAAAGCATAAGCGATTGGAGGATTTGACCAACGAAGTCAACATGTTGCAAAGTGCAAACAAGAAGTTGGTAGAGAGCATCAAGGCTAAGGAGGAAGCATATGCTGAGACAGAAGTTGATAACAACATCTTGAGAGCGCAAACCGTGGAATTGACTGATCGATTGCGCTTTTTGCACTCTATCATTCAGGTTGCGGAAAAGGCCAAAGGGTTATCTGTTAATGTAAAGATTCCAAATCTTAAGCCGTAG

Predicted protein sequences of Glyma03g15560

Limit To All Plant Sequences

>Glyma03g15560.1   sequence type=predicted peptide   gene model=Glyma03g15560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSSQSLVKSDYEGGDPPQMDETNMKRRALNREYARQSRLRKHKRLEDLTNEVNMLQSANKKLVESIKAKEEAYAETEVDNNILRAQTVELTDRLRFLHSIIQVAEKAKGLSVNVKIPNLKP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain