SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g14670

Feature Type:gene_model
Chromosome:Gm03
Start:18709449
stop:18710499
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g14670
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09085AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF962) | chr3:2782238-2782576 FORWARD LENGTH=112 SoyBaseE_val: 8.00E-48ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06127PFAM Protein of unknown function (DUF962) JGI ISS
UniRef100_F5SJT0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Desmospora sp. 8437 RepID=F5SJT0_9BACL SoyBaseE_val: 2.00E-30ISS
UniRef100_I1JLR8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLR8_SOYBN SoyBaseE_val: 9.00E-76ISS

Expression Patterns of Glyma03g14670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma03g14670
ParalogEvidenceComments
Glyma01g27280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma03g14670 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g077100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g14670
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g14670
>Glyma03g14670.1   sequence type=CDS   gene model=Glyma03g14670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTTTAGGAGCCTGGAAGATTTCTGGGCCTTCTACATGAACCAGCACTCCAAGGCTTCCACAAGGCGCTGGCACTTCGCAGGAACACTCTTCAGCATTCTCTTTTTCTTTTGTTCCCTCTTGTTCAGTTGGTGGTTCTTGCTCCTTGTCCCTTTCTCTGGGTATGGATGTGCCTTCTATAGCCACTTGTTTGTAGAGAGGAATTTCCCTGAGACTTTGAGACACCCCTTTTGGTCCCTCATGTGTGACTTCAAGATGTTCGGGTTCATGCTCACTGGCAACATGGATAGGGAGATCAAAAGGCTTGGGAAGAGACCTGTGCTGCAAGTGTTTTGA
Predicted protein sequences of Glyma03g14670
>Glyma03g14670.1   sequence type=predicted peptide   gene model=Glyma03g14670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFRSLEDFWAFYMNQHSKASTRRWHFAGTLFSILFFFCSLLFSWWFLLLVPFSGYGCAFYSHLFVERNFPETLRHPFWSLMCDFKMFGFMLTGNMDREIKRLGKRPVLQVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo