Glyma03g13810 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g13810

Feature Type:	gene_model
Chromosome:	Gm03
Start:	17498686
stop:	17500125
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g13810

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14300	AT	Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein \| chr4:8231179-8232785 FORWARD LENGTH=411	SoyBase	E_val: 7.00E-32	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
PTHR24012	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24012:SF14	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00076	PFAM	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	JGI		ISS
UniRef100_B9SQV8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heterogeneous nuclear ribonucleoprotein 27C, putative n=1 Tax=Ricinus communis RepID=B9SQV8_RICCO	SoyBase	E_val: 5.00E-34	ISS
UniRef100_I1JLP9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLP9_SOYBN	SoyBase	E_val: 3.00E-118	ISS

Expression Patterns of Glyma03g13810

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g13810 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g13810

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g13810

Limit To All Plant Sequences

>Glyma03g13810.1   sequence type=CDS   gene model=Glyma03g13810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGGATCAAGGCAAGCTTTTCATCGGTGGGATTTCATGGGATACGACGGAGGACAAGCTCAAGGAGCATTTCGGTAACTACGACGACGTTTTGAGCACTTCCGTCATGCGGGAGAAGAACACTGGGAAGCCAAGGGGCTTCGGTTTCGTCGTTTTTGCGGATCCTAACATTCTAGATAGGGTTATGGAAGACAAACATGTCATAGATGGCAGAACGAGAAAAGTGAAGCTTAGAAATACAACTCTTATTTATAAGTCACAGTGTACAGCGGATATAACGGGAAATCATAAAGTACATTTCACAAGATCACATGATTCTAAAACACTACTACTTTTTTTGTCATTTCTTTGCTTTTTGTTTAGGGTCTTAACTGTTCTCGCGGTTTGTTCATGGAGTCCTAAAGTTCTTGAACACGGCCCAGTAAATGATAAAACAGTACGGTTGGTAAGAAATGAAATAAATGAGCAGAGCACCTCTTCTTTGAGAATAGAG

Predicted protein sequences of Glyma03g13810

Limit To All Plant Sequences

>Glyma03g13810.1   sequence type=predicted peptide   gene model=Glyma03g13810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSDQGKLFIGGISWDTTEDKLKEHFGNYDDVLSTSVMREKNTGKPRGFGFVVFADPNILDRVMEDKHVIDGRTRKVKLRNTTLIYKSQCTADITGNHKVHFTRSHDSKTLLLFLSFLCFLFRVLTVLAVCSWSPKVLEHGPVNDKTVRLVRNEINEQSTSSLRIE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain