Glyma03g13520 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g13520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g13520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g13520

Feature Type:	gene_model
Chromosome:	Gm03
Start:	17162416
stop:	17164933
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g13520

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G32720	AT	Annotation by Michelle Graham. TAIR10: cytochrome B5 isoform B \| chr2:13877013-13878447 REVERSE LENGTH=134	SoyBase	E_val: 3.00E-75	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0019745	GO-bp	Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0043447	GO-bp	Annotation by Michelle Graham. GO Biological Process: alkane biosynthetic process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
KOG0537	KOG	Cytochrome b5	JGI		ISS
PTHR19359	Panther	CYTOCHROME B5	JGI		ISS
PF00173	PFAM	Cytochrome b5-like Heme/Steroid binding domain	JGI		ISS
UniRef100_G7JUJ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b5 n=1 Tax=Medicago truncatula RepID=G7JUJ2_MEDTR	SoyBase	E_val: 1.00E-79	ISS
UniRef100_I1JLP5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLP5_SOYBN	SoyBase	E_val: 6.00E-96	ISS

Expression Patterns of Glyma03g13520

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g13520 not represented in the dataset	Glyma03g13520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g13520 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g080100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g13520

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g13520

Limit To All Plant Sequences

>Glyma03g13520.1   sequence type=CDS   gene model=Glyma03g13520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGGGAGCGGAACAAGGTCTTCTCTTTGGCCGAGGTCTCTCAGCACAACAATGCCAAAGACTGTTGGCTTGTCATTCATGGCAAGGTTTATAATGTGACAAAGTTCTTGGAGGACCACCCTGGAGGGGATGAGGTCCTGTTGTCTTCCACAGGGAAAGATGCAACCAATGATTTTGAGGATATTGGTCACAGCACCAGCGCCGTAGCCATGATGGATGAGTTCTATGTTGGAGACATTGATACATCAACCATCCCCAGCAAGGTTAAGTACACTCCTCCAAAACAACCTCACTATAACCAGGACAAGATGCCGGAGTTCATCATCAGGATCCTCCAGTTTCTAGTTCCCTTGTTTATCTTGGGTTTGGCAGTTGGTATTCGTTTCTACACCAAATCAACATAA

Predicted protein sequences of Glyma03g13520

Limit To All Plant Sequences

>Glyma03g13520.1   sequence type=predicted peptide   gene model=Glyma03g13520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGERNKVFSLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDFEDIGHSTSAVAMMDEFYVGDIDTSTIPSKVKYTPPKQPHYNQDKMPEFIIRILQFLVPLFILGLAVGIRFYTKST*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain