SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g13520

Feature Type:gene_model
Chromosome:Gm03
Start:17162416
stop:17164933
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g13520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G32720AT Annotation by Michelle Graham. TAIR10: cytochrome B5 isoform B | chr2:13877013-13878447 REVERSE LENGTH=134 SoyBaseE_val: 3.00E-75ISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0019745GO-bp Annotation by Michelle Graham. GO Biological Process: pentacyclic triterpenoid biosynthetic process SoyBaseN/AISS
GO:0043447GO-bp Annotation by Michelle Graham. GO Biological Process: alkane biosynthetic process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
KOG0537 KOG Cytochrome b5 JGI ISS
PTHR19359Panther CYTOCHROME B5 JGI ISS
PF00173PFAM Cytochrome b5-like Heme/Steroid binding domain JGI ISS
UniRef100_G7JUJ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b5 n=1 Tax=Medicago truncatula RepID=G7JUJ2_MEDTR SoyBaseE_val: 1.00E-79ISS
UniRef100_I1JLP5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLP5_SOYBN SoyBaseE_val: 6.00E-96ISS

Expression Patterns of Glyma03g13520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g13520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g080100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g13520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g13520
>Glyma03g13520.1   sequence type=CDS   gene model=Glyma03g13520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGGGGAGCGGAACAAGGTCTTCTCTTTGGCCGAGGTCTCTCAGCACAACAATGCCAAAGACTGTTGGCTTGTCATTCATGGCAAGGTTTATAATGTGACAAAGTTCTTGGAGGACCACCCTGGAGGGGATGAGGTCCTGTTGTCTTCCACAGGGAAAGATGCAACCAATGATTTTGAGGATATTGGTCACAGCACCAGCGCCGTAGCCATGATGGATGAGTTCTATGTTGGAGACATTGATACATCAACCATCCCCAGCAAGGTTAAGTACACTCCTCCAAAACAACCTCACTATAACCAGGACAAGATGCCGGAGTTCATCATCAGGATCCTCCAGTTTCTAGTTCCCTTGTTTATCTTGGGTTTGGCAGTTGGTATTCGTTTCTACACCAAATCAACATAA
Predicted protein sequences of Glyma03g13520
>Glyma03g13520.1   sequence type=predicted peptide   gene model=Glyma03g13520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGGERNKVFSLAEVSQHNNAKDCWLVIHGKVYNVTKFLEDHPGGDEVLLSSTGKDATNDFEDIGHSTSAVAMMDEFYVGDIDTSTIPSKVKYTPPKQPHYNQDKMPEFIIRILQFLVPLFILGLAVGIRFYTKST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo