SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g10540

Feature Type:gene_model
Chromosome:Gm03
Start:12829038
stop:12832094
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09310AT Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF37 (InterPro:IPR002696); Has 5781 Blast hits to 5781 proteins in 1903 species: Archae - 0; Bacteria - 3956; Metazoa - 2; Fungi - 0; Plants - 42; Viruses - 3; Other Eukaryotes - 1778 (source: NCBI BLink). | chr3:2860622-2861297 REVERSE LENGTH=170 SoyBaseE_val: 2.00E-48ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01809PFAM Domain of unknown function DUF37 JGI ISS
UniRef100_Q53MC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q53MC0_ORYSJ SoyBaseE_val: 1.00E-43ISS
UniRef100_UPI000233A1C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A1C8 related cluster n=1 Tax=unknown RepID=UPI000233A1C8 SoyBaseE_val: 1.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g10540 not represented in the dataset

Glyma03g10540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g066000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g10540.1   sequence type=CDS   gene model=Glyma03g10540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACTCTCCTTCTACCCCTCAACTCCTATTCTCCCACACCAATTCGAAACCCTAATCTATCTTCTCTTAAAATCAAAGTCAACCAGCGTCACTCTCCTTTCCAAACCCGACGACTTCATCGCACCCCATTCGTTCGTGCACTGGAGGAAGATTCGAACCCTGAAACAGTCCAAGATGGCGAAGTGAACAGTTTAGGAGTCAAGGTTGCGCTGTCCATGTTGAGATTCTACCAGAGGGAAATTTCACCAATTTTGCCAAAGAGCTGTCGATACATTCCAACCTGCAGTGAGTATTCCATGGAGGCATATAAGCGATATGGAGCGGTGAAGGGTACAGTTTTAACTGCGTGGCGTATATGTCGTTGCAATCCCCTTGGTGGGCATGGTTACGATCCACCTAGATGGTTTGGGGAGGTTAGTCCATTAGAAGATGCCCGCGACTGA

>Glyma03g10540.1   sequence type=predicted peptide   gene model=Glyma03g10540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLLLPLNSYSPTPIRNPNLSSLKIKVNQRHSPFQTRRLHRTPFVRALEEDSNPETVQDGEVNSLGVKVALSMLRFYQREISPILPKSCRYIPTCSEYSMEAYKRYGAVKGTVLTAWRICRCNPLGGHGYDPPRWFGEVSPLEDARD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo