SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g10355

Feature Type:gene_model
Chromosome:Gm03
Start:12714004
stop:12714539
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38660AT Annotation by Michelle Graham. TAIR10: Amino acid dehydrogenase family protein | chr2:16166392-16168282 FORWARD LENGTH=332 SoyBaseE_val: 7.00E-64ISS
GO:0009396GO-bp Annotation by Michelle Graham. GO Biological Process: folic acid-containing compound biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004488GO-mf Annotation by Michelle Graham. GO Molecular Function: methylenetetrahydrofolate dehydrogenase (NADP+) activity SoyBaseN/AISS
PTHR10025Panther METHYLENETETRAHYDROFOLATE DEHYDROGENASE JGI ISS
PF02882PFAM Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain JGI ISS
UniRef100_G7IV98UniRef Annotation by Michelle Graham. Most informative UniRef hit: FolD bifunctional protein n=1 Tax=Medicago truncatula RepID=G7IV98_MEDTR SoyBaseE_val: 2.00E-75ISS
UniRef100_I1JLK2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JLK2_SOYBN SoyBaseE_val: 5.00E-101ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g10355 not represented in the dataset

Glyma03g10355 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g065800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g10355.1   sequence type=CDS   gene model=Glyma03g10355   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCATTTGGACGAGGAAAAAATTATCAATGTTGTGAGTCCTGAAAAGGATGTGGATGGCTTTCATCCCTTAAATATTGGAAATCTTGCAATAAGAGGAAGAAAGCCCTTCTTTGTTCCTTGTGCTCCTAAGGGCTGCATTGAGTTGTTACTTAGTCACGGTGTGGAAATCAAGGGGAAAAGAGCAGTGATAATTGGAAGAAGTAAAATTGTGGGGTTACCCACTTCCTTGCTATTGCAGAGGCACCACGCAACAGTCAGCGTGTTACACGCGTATACGAAGAACCCAGAACATATAACTTCTGAAGCAGATATTGTGGTAGTAGTAGATGTTGGAGTCCCCAACATAGTTCGTGGCAATTGGCTAAAGAAAGGAGTTGTGGTGATTGACATGGGAACAAATCAAGTTAAGGTAATGATTTTTTTCTTCAGTATTTTAGTTGTGCCAATGACTTCTTAA

>Glyma03g10355.1   sequence type=predicted peptide   gene model=Glyma03g10355   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQHLDEEKIINVVSPEKDVDGFHPLNIGNLAIRGRKPFFVPCAPKGCIELLLSHGVEIKGKRAVIIGRSKIVGLPTSLLLQRHHATVSVLHAYTKNPEHITSEADIVVVVDVGVPNIVRGNWLKKGVVVIDMGTNQVKVMIFFFSILVVPMTS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo