|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00710 | AT | Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein H | chrC:74485-74706 FORWARD LENGTH=73 | SoyBase | E_val: 3.00E-35 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0009769 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem II | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0050821 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein stabilization | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009523 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: photosystem II | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009654 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0042301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphate ion binding | SoyBase | N/A | ISS |
| PF00737 | PFAM | Photosystem II 10 kDa phosphoprotein | JGI | ISS | |
| UniRef100_Q2PMQ6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein H n=1 Tax=Glycine max RepID=PSBH_SOYBN | SoyBase | E_val: 4.00E-37 | ISS |
| UniRef100_Q2PMQ6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein H n=1 Tax=Glycine max RepID=PSBH_SOYBN | SoyBase | E_val: 4.00E-37 | ISS |
|
Glyma03g09765 not represented in the dataset |
Glyma03g09765 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g065000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g09765.1 sequence type=CDS gene model=Glyma03g09765 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTACACAAACCGCTGGGGATAATTCTATATCTGGTCCAAGACGAACTGTTGTAGGGGATTTATTGAAACCATTAAATTCAGAATATGGTAAAGTAGCTCCAGAATGGGAAACTACTCCTTTGACGGGTGTTGCAATGGCTCTATTTGTGATACTTCTATCTATTATTTTGGAGATTTATAATTCGTCCATTTTACTGGACGGAATTTCTATGAATTAG
>Glyma03g09765.1 sequence type=predicted peptide gene model=Glyma03g09765 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MATQTAGDNSISGPRRTVVGDLLKPLNSEYGKVAPEWETTPLTGVAMALFVILLSIILEIYNSSILLDGISMN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||