Glyma03g09410 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g09410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g09410): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g09410

Feature Type:	gene_model
Chromosome:	Gm03
Start:	11021169
stop:	11024206
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g09410

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48720	AT	Annotation by Michelle Graham. TAIR10: x-ray induced transcript 1 \| chr5:19760038-19761621 FORWARD LENGTH=266	SoyBase	E_val: 1.00E-53	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006302	GO-bp	Annotation by Michelle Graham. GO Biological Process: double-strand break repair	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007140	GO-bp	Annotation by Michelle Graham. GO Biological Process: male meiosis	SoyBase	N/A	ISS
GO:0007143	GO-bp	Annotation by Michelle Graham. GO Biological Process: female meiosis	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0010165	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to X-ray	SoyBase	N/A	ISS
GO:0010332	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gamma radiation	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_Q6NLW5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein XRI1 n=2 Tax=Arabidopsis thaliana RepID=XRI1_ARATH	SoyBase	E_val: 4.00E-50	ISS
UniRef100_UPI000233A050	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A050 related cluster n=1 Tax=unknown RepID=UPI000233A050	SoyBase	E_val: 3.00E-152	ISS

Expression Patterns of Glyma03g09410

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09410 not represented in the dataset	Glyma03g09410 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09410 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g064200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g09410

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g09410

Limit To All Plant Sequences

>Glyma03g09410.2   sequence type=CDS   gene model=Glyma03g09410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTACAGTTCAACAGCCAAGATAGCGATCAATCTCTATCCAATGAAGAGATGTCTTTGTCATATTTAAAAAATGGGAAGGAAGACCCAGTTAAGGAGATTTTTCCAGAGGTGTCGCAATGGGTATCGGGTGCATCAGATTACACTATAGGAAATGCATCTGCATCTGATTATGTGGACCTTGAATCAACTGAAACATGGCTTGCGGATTACTTTAATGATGCTGTGATGGATTTCAGTCCTGAGGAATTGAATTTTTCAGTGGCAGACGGTGTTCAAATTGATGATGGTACAGAGGTTAGTGCCATCACACCATCACATGAACAAAATGTGGTTCAACAAACGCATGTCCCTCGAACCACTTGTAATATTATCTTCAAAGGTAGGAAATCTTTTATACATATGCCGACGAAGTTGGCTTCTTCTGTGGCCTATCCATTTGCCTTCATTAAACCAAGTGGTGCTCATGGAGATGTAACTCTGAAGGAAATAAATCAGCGCATTCAAACACCATCTCCTTCGAAATCAAACCAAAGCATTGATGATGATCCATCTGCTTACCCCAAGTCAGCCTTCTCTGGGAAGCCTGTGGTTGGTAAAACAAAAATTCGCACTGAAGGTGGAAAAGGTAGCATAACAATTACCAGAACTAAAGGTTAG

Predicted protein sequences of Glyma03g09410

Limit To All Plant Sequences

>Glyma03g09410.2   sequence type=predicted peptide   gene model=Glyma03g09410   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLQFNSQDSDQSLSNEEMSLSYLKNGKEDPVKEIFPEVSQWVSGASDYTIGNASASDYVDLESTETWLADYFNDAVMDFSPEELNFSVADGVQIDDGTEVSAITPSHEQNVVQQTHVPRTTCNIIFKGRKSFIHMPTKLASSVAYPFAFIKPSGAHGDVTLKEINQRIQTPSPSKSNQSIDDDPSAYPKSAFSGKPVVGKTKIRTEGGKGSITITRTKG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain