SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g09342

Feature Type:gene_model
Chromosome:Gm03
Start:10889867
stop:10891329
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g09342
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G22930AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF1635) | chr5:7668229-7669315 REVERSE LENGTH=238 SoyBaseE_val: 2.00E-33ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF07795PFAM Protein of unknown function (DUF1635) JGI ISS
UniRef100_C6SZ23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZ23_SOYBN SoyBaseE_val: 1.00E-90ISS
UniRef100_Q9FFB5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB89309.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FFB5_ARATH SoyBaseE_val: 6.00E-31ISS

Expression Patterns of Glyma03g09342
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09342 not represented in the dataset
Glyma03g09342 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09342 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g064100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g09342
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g09342
>Glyma03g09342.1   sequence type=CDS   gene model=Glyma03g09342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCATCATCTGCTAGGGAAAAGTAGGGGCCCCTGTACTCCAATTCACACTCACAACTACCATAGCAGCAACGTTCTTTCTGTTTCTGCTAGAAAGCTCGCCACGGCTCTTTGGGAATTCAACCACTCTTTCCTACTCTTTCAAATGCATCATCATCGTTCTGCTAACAACGCTTCCGCTGCTGCTGCCAGCGGAGCTGGCGCTGATCCCAGACTTCGCCGCCATCACCATTACATCCTTCATAAGGACAGGGCTCCGGTCATCTCCAACTTTTTGGCTGATGCTTCTCCCAGTTCCCCCGATCAGGGGTTAGAGGACTTGAGAAATTCTCTTTTGTACACAACCTTGTTGCTAGATGCAACAATTGCATCAGCTAAGGAGGAGATTACAAGAAGAGAATGTGAATTGATCCATGTGAATGACCTCTTAAGCAGGAAGCAACAGCTAGAACAACACCAATTTGTTCAAACACATCAAAGAGATACCATATCACAAAGTGAAGAAGAGCAACAAGAAGGCTTCTCTGAAAAGCATTCTGCATCTTCTGGCTGTGAAGGAAACAACAACATGCCCTCTCCTGGTGGAAGTTCAACCCCACATCAAACAACACCACTGCAGGTGGTAATGGAGTTGGCAGAAAAGAAACCATTGCCTAAAAAAGGGAAACTCTTAAAGGCAGTGGTGGAAGCTGGACCACTGCTTCAGACACTTTTCTTAGCAGGACCAGTCCCACAGTGGCAACACCCTCCTCCACAACTCAACTCCATTGAGATCCCCCCAGTGGCCATTTCACCCCAACAAGACTCTTCTTCTACCAAA
Predicted protein sequences of Glyma03g09342
>Glyma03g09342.1   sequence type=predicted peptide   gene model=Glyma03g09342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCHHLLGKSRGPCTPIHTHNYHSSNVLSVSARKLATALWEFNHSFLLFQMHHHRSANNASAAAASGAGADPRLRRHHHYILHKDRAPVISNFLADASPSSPDQGLEDLRNSLLYTTLLLDATIASAKEEITRRECELIHVNDLLSRKQQLEQHQFVQTHQRDTISQSEEEQQEGFSEKHSASSGCEGNNNMPSPGGSSTPHQTTPLQVVMELAEKKPLPKKGKLLKAVVEAGPLLQTLFLAGPVPQWQHPPPQLNSIEIPPVAISPQQDSSSTK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo