SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g09100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g09100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g09100

Feature Type:gene_model
Chromosome:Gm03
Start:10607399
stop:10616175
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g09100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38120AT Annotation by Michelle Graham. TAIR10: Transmembrane amino acid transporter family protein | chr2:15973493-15976792 FORWARD LENGTH=485 SoyBaseE_val: 0ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0001736GO-bp Annotation by Michelle Graham. GO Biological Process: establishment of planar polarity SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0006949GO-bp Annotation by Michelle Graham. GO Biological Process: syncytium formation SoyBaseN/AISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0009958GO-bp Annotation by Michelle Graham. GO Biological Process: positive gravitropism SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0048829GO-bp Annotation by Michelle Graham. GO Biological Process: root cap development SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009986GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell surface SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0010011GO-mf Annotation by Michelle Graham. GO Molecular Function: auxin binding SoyBaseN/AISS
GO:0010328GO-mf Annotation by Michelle Graham. GO Molecular Function: auxin influx transmembrane transporter activity SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
KOG1303 KOG Amino acid transporters JGI ISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PTHR22950:SF14Panther SUBFAMILY NOT NAMED JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_I1JLI6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JLI6_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q76DT1UniRef Annotation by Michelle Graham. Most informative UniRef hit: AUX1-like auxin influx carrier protein n=1 Tax=Pisum sativum RepID=Q76DT1_PEA SoyBaseE_val: 0ISS

Expression Patterns of Glyma03g09100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09100 not represented in the dataset
Glyma03g09100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g063600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g09100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g09100
>Glyma03g09100.1   sequence type=CDS   gene model=Glyma03g09100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTCTCAGAAGCAAGCAGAGGAAGCTATAGTCACAAACGAGACAGAACATGAAGTTAGCAGCACAAGGGAAGAGGAGAAGGAGCAAGACCAATCAATGTTCAGCCTTAAGAGCATCCTTTGGCATGGTGGTTCTGTTTGGGATGCATGGTTCAGCTGTGCCTCAAATCAAGTGGCTCAAGTGCTTTTGACACTGCCATACTCATTCTCTCAACTTGGCATGCTATCAGGAATCATTTTTCAGGTGTTCTATGGAATTGTTGGAAGCTGGACTGCTTATCTAATCAGTGTCCTCTACATAGAGTACCGCACCAGAAAGGAAAAGGAAAACGTCAGCTTCAAAAACCATGTCATTCAGTGGTTCGAAGTCCTTGATGGGTTACTTGGTCCATATTGGAAAGCCCTGGGGCTAGCCTTCAACTGTACTTTCCTTCTCTTTGGATCTGTGATACAGCTTATAGCATGTGCAAGTAACATATACTACATAAATGACAAATTGGATAAACGGACTTGGACTTATATTTTTGGAGCTTGCTGTGCCACCACTGTGTTCATACCTTCCTTCCACAATTACCGAATCTGGTCTTTTTTGGGTCTTGGAATGACCACTTACACGGCTTGGTACCTTGCTATTGCAGCCATCCTTCATGGCCAGGTGGAAAATGTCACGCACACGGGTCCATCAAAGCTAGTGCTATACTTCACTGGAGCCACTAACATACTCTACACGTTTGGAGGACATGCTGTGACTGTAGAGATTATGCATGCCATGTGGAAGCCCCAAAAGTTCAAGTACATCTACTTGCTGGCCACTTTGTACGTTTTCACGCTAACGATTCCGTCCGCCGTCGCCGTTTATTGGGCTTTTGGTGATATGCTTCTTAACCACTCAAATGCATTCTCTCTCCTCCCAAAGAATGGTTTCCGTGACGCCGCCGTTATCCTCATGCTCATTCACCAGTTCATCACATTCGGGTTCGCGTGTACTCCATTGTACTTCGTGTGGGAGAAGGTGATTGGGATGCACGACACAAAGAGCATTTGTTTGAGGGCACTTGCACGGTTACCAGTGGTGATACCTATATGGTTCTTGGCCATAATCTTCCCTTTCTTTGGGCCCATAAATTCAGCTGTTGGATCTCTACTCGTTAGCTTCACTGTCTACATCATCCCTTCCTTAGCCCATATGCTCACTTACAGAAAAGCCTCTGCCAGACAGAATGCTGCAGAGAAGCCTCCTTTCTTCATGCCAAGCTGGACTGCAATGTATGTCTTCAATGCATTCATTGTGGTATGGGTTTTTGTAGTTGGATTTGGGCTTGGAGGATGGGCCAGCATGACCAACTTCATAAGGCAAATTGACACATTTGGGCTTTTTGCCAAATGCTACCAGTGCCCTCCACCAGCACCAAAAGTTGTGGCAGCACCACCCCCTCATGCTCATCATTAG
Predicted protein sequences of Glyma03g09100
>Glyma03g09100.1   sequence type=predicted peptide   gene model=Glyma03g09100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSQKQAEEAIVTNETEHEVSSTREEEKEQDQSMFSLKSILWHGGSVWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGIIFQVFYGIVGSWTAYLISVLYIEYRTRKEKENVSFKNHVIQWFEVLDGLLGPYWKALGLAFNCTFLLFGSVIQLIACASNIYYINDKLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAAILHGQVENVTHTGPSKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLLATLYVFTLTIPSAVAVYWAFGDMLLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFMPSWTAMYVFNAFIVVWVFVVGFGLGGWASMTNFIRQIDTFGLFAKCYQCPPPAPKVVAAPPPHAHH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo