Glyma03g09070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g09070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g09070): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g09070

Feature Type:	gene_model
Chromosome:	Gm03
Start:	10445693
stop:	10447611
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g09070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75760	AT	Annotation by Michelle Graham. TAIR10: ER lumen protein retaining receptor family protein \| chr1:28446940-28448421 REVERSE LENGTH=272	SoyBase	E_val: 2.00E-42	ISS
GO:0006007	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose catabolic process	SoyBase	N/A	ISS
GO:0006621	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein retention in ER lumen	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0046923	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ER retention sequence binding	SoyBase	N/A	ISS
PTHR10585	Panther	ER LUMEN PROTEIN RETAINING RECEPTOR-RELATED	JGI		ISS
PTHR10585:SF10	Panther	ER LUMEN PROTEIN RETAINING RECEPTOR	JGI		ISS
PF00810	PFAM	ER lumen protein retaining receptor	JGI		ISS
PF08646	PFAM	Replication factor-A C terminal domain	JGI		ISS
UniRef100_B9R890	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ER lumen protein retaining receptor, putative n=1 Tax=Ricinus communis RepID=B9R890_RICCO	SoyBase	E_val: 4.00E-40	ISS
UniRef100_C6TK85	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TK85_SOYBN	SoyBase	E_val: 1.00E-42	ISS

Expression Patterns of Glyma03g09070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09070 not represented in the dataset	Glyma03g09070 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g09070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g09070

Limit To All Plant Sequences

>Glyma03g09070.1   sequence type=CDS   gene model=Glyma03g09070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACACGTTTCAAATTGAAATCTAGTTATATAGATGATAAGGTCAACCTTGCAATATACTATGTGGTAATACCTTGTGTTGTGCTGTCCTTGATTCTCTGGGCATTTTGTGTTTATCTTGAAGCTGTTTCTGTTCTCCCTCAGCTGCGGGTCATGCAGAACACTAAGATTGTTGAACCATTCATAGCACACTATATTTTTGCTCTTGGAGTTGCAAGGTTCTTGAGTTGTGCACAATGGGTCCTCCAGACTATATCTCAAATTAAAGATGAGAAGTTAGGGACTTTAGAGAAGCCTGATTGGATATTTGTCTTTGTAGTTGTTTCACACATTAAGGTTGATAACTTCTGTTACCCAGGGTGCCCTCTCAAGATAGGGGATAGACAATGTAACAAAAAGGTGACTAATAATGCAGATGGGACATGGCATTGTGAAAGA

Predicted protein sequences of Glyma03g09070

Limit To All Plant Sequences

>Glyma03g09070.1   sequence type=predicted peptide   gene model=Glyma03g09070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TRFKLKSSYIDDKVNLAIYYVVIPCVVLSLILWAFCVYLEAVSVLPQLRVMQNTKIVEPFIAHYIFALGVARFLSCAQWVLQTISQIKDEKLGTLEKPDWIFVFVVVSHIKVDNFCYPGCPLKIGDRQCNKKVTNNADGTWHCER

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain