Glyma03g09050 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g09050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g09050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g09050

Feature Type:	gene_model
Chromosome:	Gm03
Start:	10373779
stop:	10375240
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g09050

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09020	AT	Annotation by Michelle Graham. TAIR10: alpha 1,4-glycosyltransferase family protein \| chr3:2753307-2754542 FORWARD LENGTH=411	SoyBase	E_val: 2.00E-90	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0009595	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0043900	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process	SoyBase	N/A	ISS
GO:0045088	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response	SoyBase	N/A	ISS
GO:0050832	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0008378	GO-mf	Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity	SoyBase	N/A	ISS
GO:0016740	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PTHR12042	Panther	LACTOSYLCERAMIDE 4-ALPHA-GALACTOSYLTRANSFERASE (ALPHA- 1,4-GALACTOSYLTRANSFERASE)	JGI		ISS
PF04488	PFAM	Glycosyltransferase sugar-binding region containing DXD motif	JGI		ISS
PF04572	PFAM	Alpha 1,4-glycosyltransferase conserved region	JGI		ISS
UniRef100_G7KRB0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lactosylceramide 4-alpha-galactosyltransferase n=1 Tax=Medicago truncatula RepID=G7KRB0_MEDTR	SoyBase	E_val: 6.00E-125	ISS
UniRef100_I1JLI3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JLI3_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma03g09050

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09050 not represented in the dataset	Glyma03g09050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09050 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma03g09050

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g09050

Limit To All Plant Sequences

>Glyma03g09050.2   sequence type=CDS   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTGCATAAGTTCTTTCCAATTGCAACTCTCACCAGACACAATAATCCAAAAGTTGTTTGTTCATCGGCTGCTTAAACATGCCAAGTTATCTGTCTTCCCTCTAATCACTTTCTCTGCCATAATTTTTCTTATCTATGCTGATAGTATTATCTACCATGATTCATTACACTCAGCAACTAATAAAGAAGCTACAGAGAAGTTGGAAGTTCACAATCACAGAACAAAAGAAGAAATAAGGTCAACACTTGTTCTCATACCTTTACATTCCATTCGAGAGAAGGATGAAGCTGATAGTCAAAAACAGAAGGCTCTAGTCACCCCATTAAATGTCACAGAAGAAGAAAGACAAACATGTTTATTTGGAGGGAGAGAATTGCTTCCTGTGGAAAGCATTTTCAAGAACCATCCTAAGGCATGTCTGACAATTCTATCAAGAACTTTGGACACCAAGCATGGCTACAGGATCCTGAAACCACTGCTTGATCGTAGGTTCAAAGTGCAGGCAATGGCCCCAGACTTGCCATTTTTGGTCAAGGGGACTCCGGTCGAAGCTTGGTTTCGTGAGCTAAGGAAGGGTAGAAAGGACCCCAGTGAGATTCCTTTGTCTCAGAATCTATCTAATCTGATAAGACTTGCAGTTCTGTACAAATATGGTGGTGTCTACATAGATACATACTTTATACTTTATAGTAAGCACTGGACTAGATTAAATAATGCAGTTCTGATTTTTGATATTGGACATCCACTTCGGCACAGATTCATCAATGAATTTGCCTTGACTTTCAATGGAAACAAATGGGGGAATAATGGTCCCTACCTGGTTTCCAGAGTGATTAAGAGGCTGTTTAAAAGACATGATTTCAACTTTACAATCTTGCCGCCTATGGCCTTTTATCCAGTGGATTGGAACAAGATAAAATCAAGACGGGTAGAAGCCAACCTGCTTCAGCTCAGTGGGAAGACTTATGGGATTCATCTATGGAATAAACATAGTAGCAGATTGACAATTGAAGATGGAAGTGTCATTGGAAGACTTATATCAGATTACTGTGAAACACTCTAG

Predicted protein sequences of Glyma03g09050

Limit To All Plant Sequences

>Glyma03g09050.2   sequence type=predicted peptide   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFCISSFQLQLSPDTIIQKLFVHRLLKHAKLSVFPLITFSAIIFLIYADSIIYHDSLHSATNKEATEKLEVHNHRTKEEIRSTLVLIPLHSIREKDEADSQKQKALVTPLNVTEEERQTCLFGGRELLPVESIFKNHPKACLTILSRTLDTKHGYRILKPLLDRRFKVQAMAPDLPFLVKGTPVEAWFRELRKGRKDPSEIPLSQNLSNLIRLAVLYKYGGVYIDTYFILYSKHWTRLNNAVLIFDIGHPLRHRFINEFALTFNGNKWGNNGPYLVSRVIKRLFKRHDFNFTILPPMAFYPVDWNKIKSRRVEANLLQLSGKTYGIHLWNKHSSRLTIEDGSVIGRLISDYCETL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain