SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g09050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g09050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g09050

Feature Type:gene_model
Chromosome:Gm03
Start:10373779
stop:10375240
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09020AT Annotation by Michelle Graham. TAIR10: alpha 1,4-glycosyltransferase family protein | chr3:2753307-2754542 FORWARD LENGTH=411 SoyBaseE_val: 2.00E-90ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0045088GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of innate immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0008378GO-mf Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PTHR12042Panther LACTOSYLCERAMIDE 4-ALPHA-GALACTOSYLTRANSFERASE (ALPHA- 1,4-GALACTOSYLTRANSFERASE) JGI ISS
PF04488PFAM Glycosyltransferase sugar-binding region containing DXD motif JGI ISS
PF04572PFAM Alpha 1,4-glycosyltransferase conserved region JGI ISS
UniRef100_G7KRB0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lactosylceramide 4-alpha-galactosyltransferase n=1 Tax=Medicago truncatula RepID=G7KRB0_MEDTR SoyBaseE_val: 6.00E-125ISS
UniRef100_I1JLI3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JLI3_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g09050 not represented in the dataset

Glyma03g09050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g09050.2   sequence type=CDS   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTCTGCATAAGTTCTTTCCAATTGCAACTCTCACCAGACACAATAATCCAAAAGTTGTTTGTTCATCGGCTGCTTAAACATGCCAAGTTATCTGTCTTCCCTCTAATCACTTTCTCTGCCATAATTTTTCTTATCTATGCTGATAGTATTATCTACCATGATTCATTACACTCAGCAACTAATAAAGAAGCTACAGAGAAGTTGGAAGTTCACAATCACAGAACAAAAGAAGAAATAAGGTCAACACTTGTTCTCATACCTTTACATTCCATTCGAGAGAAGGATGAAGCTGATAGTCAAAAACAGAAGGCTCTAGTCACCCCATTAAATGTCACAGAAGAAGAAAGACAAACATGTTTATTTGGAGGGAGAGAATTGCTTCCTGTGGAAAGCATTTTCAAGAACCATCCTAAGGCATGTCTGACAATTCTATCAAGAACTTTGGACACCAAGCATGGCTACAGGATCCTGAAACCACTGCTTGATCGTAGGTTCAAAGTGCAGGCAATGGCCCCAGACTTGCCATTTTTGGTCAAGGGGACTCCGGTCGAAGCTTGGTTTCGTGAGCTAAGGAAGGGTAGAAAGGACCCCAGTGAGATTCCTTTGTCTCAGAATCTATCTAATCTGATAAGACTTGCAGTTCTGTACAAATATGGTGGTGTCTACATAGATACATACTTTATACTTTATAGTAAGCACTGGACTAGATTAAATAATGCAGTTCTGATTTTTGATATTGGACATCCACTTCGGCACAGATTCATCAATGAATTTGCCTTGACTTTCAATGGAAACAAATGGGGGAATAATGGTCCCTACCTGGTTTCCAGAGTGATTAAGAGGCTGTTTAAAAGACATGATTTCAACTTTACAATCTTGCCGCCTATGGCCTTTTATCCAGTGGATTGGAACAAGATAAAATCAAGACGGGTAGAAGCCAACCTGCTTCAGCTCAGTGGGAAGACTTATGGGATTCATCTATGGAATAAACATAGTAGCAGATTGACAATTGAAGATGGAAGTGTCATTGGAAGACTTATATCAGATTACTGTGAAACACTCTAG

>Glyma03g09050.2   sequence type=predicted peptide   gene model=Glyma03g09050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFCISSFQLQLSPDTIIQKLFVHRLLKHAKLSVFPLITFSAIIFLIYADSIIYHDSLHSATNKEATEKLEVHNHRTKEEIRSTLVLIPLHSIREKDEADSQKQKALVTPLNVTEEERQTCLFGGRELLPVESIFKNHPKACLTILSRTLDTKHGYRILKPLLDRRFKVQAMAPDLPFLVKGTPVEAWFRELRKGRKDPSEIPLSQNLSNLIRLAVLYKYGGVYIDTYFILYSKHWTRLNNAVLIFDIGHPLRHRFINEFALTFNGNKWGNNGPYLVSRVIKRLFKRHDFNFTILPPMAFYPVDWNKIKSRRVEANLLQLSGKTYGIHLWNKHSSRLTIEDGSVIGRLISDYCETL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo