|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G16810 | AT | Annotation by Michelle Graham. TAIR10: pumilio 24 | chr3:5723436-5727539 REVERSE LENGTH=641 | SoyBase | E_val: 2.00E-24 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006406 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus | SoyBase | N/A | ISS |
| GO:0006606 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into nucleus | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| PTHR13389 | Panther | UNCHARACTERIZED | JGI | ISS | |
| UniRef100_B9RTB1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein penguin, putative n=1 Tax=Ricinus communis RepID=B9RTB1_RICCO | SoyBase | E_val: 6.00E-26 | ISS |
| UniRef100_UPI000233A04A | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A04A related cluster n=1 Tax=unknown RepID=UPI000233A04A | SoyBase | E_val: 2.00E-78 | ISS |
|
Glyma03g09003 not represented in the dataset |
Glyma03g09003 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g063100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g09003.1 sequence type=CDS gene model=Glyma03g09003 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGGCGAAGAAGCATGACGTCGGAGACACCAAAAAGAGAAAGAGACTCAATACTAAAACTCAAAAAGATCCCAAGGCTTCAAAGCTCGTTGCCTCAAAGAAGCACAAACTAGACTCCGTTGCTAAAGACAACAAGAACAAGAAGACGACTCCTCTTACCGGCCAAGAACGTCGTCTTCATTCCAAGGAACTAGCAGATGCTAGAAAAAAGAAGAGAAAGCGACATTTCACTCTTGAGCAAGAGCTTGCGCGTCTATGGGAAAAGATGAGACGTCATGAGATTGCTAAAGAGGACAGAGCTAAGCTAGTGACTGAAGCTTTGCAAAAGATGAAGGGGAAGATTCCAGAGATTGCAAAAAGGAATGTGTGA
>Glyma03g09003.1 sequence type=predicted peptide gene model=Glyma03g09003 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAAKKHDVGDTKKRKRLNTKTQKDPKASKLVASKKHKLDSVAKDNKNKKTTPLTGQERRLHSKELADARKKKRKRHFTLEQELARLWEKMRRHEIAKEDRAKLVTEALQKMKGKIPEIAKRNV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||