SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g08923

Feature Type:gene_model
Chromosome:Gm03
Start:10176037
stop:10178901
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma03g08923
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18660AT Annotation by Michelle Graham. TAIR10: zinc finger (C3HC4-type RING finger) family protein | chr1:6421433-6425565 FORWARD LENGTH=486 SoyBaseE_val: 9.00E-21ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004176GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23327Panther UNCHARACTERIZED JGI ISS
PF02190PFAM ATP-dependent protease La (LON) domain JGI ISS
UniRef100_B9RLV0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Kinase, putative n=1 Tax=Ricinus communis RepID=B9RLV0_RICCO SoyBaseE_val: 2.00E-22ISS
UniRef100_I1JWS1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWS1_SOYBN SoyBaseE_val: 6.00E-28ISS

Expression Patterns of Glyma03g08923
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g08923 not represented in the dataset
Glyma03g08923 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g08923 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g062700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma03g08923
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma03g08923
>Glyma03g08923.1   sequence type=CDS   gene model=Glyma03g08923   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGAGGAATTTAGCAGTCAATGCAAAGAGGTAAATCAAAGAGAATGGATTGGACAAACTCACCAGGCTATACTTGATTCAACGGGTTCCTTAGCTGAGTTTGCCTGTGAAGTGGAAATAACAGAGTGTGAACGACTTCCAGATGGTCATTTTTATATAAAGATTGAAAGTTGTTGGAGATTTCGTATCATCCGTTCCTGGGATCAAGATGGGTACCATGTTGCAGAGGTTGAATGGATACAAGATATATAG
Predicted protein sequences of Glyma03g08923
>Glyma03g08923.1   sequence type=predicted peptide   gene model=Glyma03g08923   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEEFSSQCKEVNQREWIGQTHQAILDSTGSLAEFACEVEITECERLPDGHFYIKIESCWRFRIIRSWDQDGYHVAEVEWIQDI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo