SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma03g08772

Feature Type:gene_model
Chromosome:Gm03
Start:9911205
stop:9912362
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13850AT Annotation by Michelle Graham. TAIR10: glycine-rich RNA-binding protein 2 | chr4:8021314-8022065 FORWARD LENGTH=144 SoyBaseE_val: 3.00E-19ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0031564GO-bp Annotation by Michelle Graham. GO Biological Process: transcription antitermination SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0001072GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding transcription antitermination factor activity SoyBaseN/AISS
GO:0003690GO-mf Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PTHR24012:SF31Panther SUBFAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_P93486UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA-binding protein n=1 Tax=Pisum sativum RepID=P93486_PEA SoyBaseE_val: 4.00E-28ISS
UniRef100_UPI0002337195UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337195 related cluster n=1 Tax=unknown RepID=UPI0002337195 SoyBaseE_val: 2.00E-45ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g08772 not represented in the dataset

Glyma03g08772 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g061500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma03g08772.1   sequence type=CDS   gene model=Glyma03g08772   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTAATTACATTCGATGCATGTCTTCAAGCAAGCTTTTCATTGGAGGCCTTTCATATGGAGTTGATGATCAGTCTCTTAAGGATGCATCTTCTGGCTTTGGATATGTGGTTGATGGAATATTGTCCCATATTCTACTATTGATTTCTGTTGCACCCCTAGATTTTTGTTTGCTGTTGGAATTTGTGTACAAAATATCATTTTCTGTCTGGCCATTTCACCTGGGATTTGGATTTGTCAACTTCTCAAATGATGAGTCTGCAAGTTCGACACTCTCTACAATGGATGGGAAGGATCTAAATGGGCCAAGCATTAGGGTATACTATGCAAATGATGGACCTTTTGGACCTCAATCTGGCGGTAGCGGGTTATTGCAATGGGGGTTTTGA

>Glyma03g08772.1   sequence type=predicted peptide   gene model=Glyma03g08772   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLNYIRCMSSSKLFIGGLSYGVDDQSLKDASSGFGYVVDGILSHILLLISVAPLDFCLLLEFVYKISFSVWPFHLGFGFVNFSNDESASSTLSTMDGKDLNGPSIRVYYANDGPFGPQSGGSGLLQWGF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo