|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G44800 | AT | Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein | chr1:16914342-16916858 REVERSE LENGTH=370 | SoyBase | E_val: 6.00E-38 | ISS |
| GO:0006865 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid transport | SoyBase | N/A | ISS |
| GO:0032973 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid export | SoyBase | N/A | ISS |
| GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS |
| GO:0080144 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid homeostasis | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0015171 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0034639 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: L-amino acid efflux transmembrane transporter activity | SoyBase | N/A | ISS |
| PF00892 | PFAM | EamA-like transporter family | JGI | ISS | |
| UniRef100_G7J313 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7J313_MEDTR | SoyBase | E_val: 2.00E-55 | ISS |
| UniRef100_UPI000233A03E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233A03E related cluster n=1 Tax=unknown RepID=UPI000233A03E | SoyBase | E_val: 1.00E-77 | ISS |
|
Glyma03g08050 not represented in the dataset |
Glyma03g08050 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g059100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma03g08050.2 sequence type=CDS gene model=Glyma03g08050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAATGGAACAGGCCAGTGCTAGATCAGAACTTGTACAACATGGGGATGAAAATGACCTCAACAACGTTTGCATCCACCACTGTTAATGTCCTCCCGGCCATTACTTTTGTAATGGCACTCGTTTTCAGGCTAGAGAAGGTGAACTTGAGAAAATTTCACAGTGTAGCCAAGGTCATTGGAACCGTCATAACAGTTTCAGGAGCTATGGTTATGACTCTGTACAAAGGCCCTGCCTTCCAAATCATAAAGGGTGGAGGAGCCATGAGCCACCATAGCAACTCTAGCAGTACCAGTACCACCGAACCCTCTGACCAGCACTGGATAGTTGGAACTGTTTATCTCCTATTTCTTCATTTTTTTCCAATCTAG
>Glyma03g08050.2 sequence type=predicted peptide gene model=Glyma03g08050 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKWNRPVLDQNLYNMGMKMTSTTFASTTVNVLPAITFVMALVFRLEKVNLRKFHSVAKVIGTVITVSGAMVMTLYKGPAFQIIKGGGAMSHHSNSSSTSTTEPSDQHWIVGTVYLLFLHFFPI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||