Glyma03g08050 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma03g08050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma03g08050): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma03g08050

Feature Type:	gene_model
Chromosome:	Gm03
Start:	8880188
stop:	8881027
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g08050

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G44800	AT	Annotation by Michelle Graham. TAIR10: nodulin MtN21 /EamA-like transporter family protein \| chr1:16914342-16916858 REVERSE LENGTH=370	SoyBase	E_val: 6.00E-38	ISS
GO:0006865	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transport	SoyBase	N/A	ISS
GO:0032973	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid export	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0080144	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid homeostasis	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0015171	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity	SoyBase	N/A	ISS
GO:0034639	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-amino acid efflux transmembrane transporter activity	SoyBase	N/A	ISS
PF00892	PFAM	EamA-like transporter family	JGI		ISS
UniRef100_G7J313	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 5NG4 n=1 Tax=Medicago truncatula RepID=G7J313_MEDTR	SoyBase	E_val: 2.00E-55	ISS
UniRef100_UPI000233A03E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A03E related cluster n=1 Tax=unknown RepID=UPI000233A03E	SoyBase	E_val: 1.00E-77	ISS

Expression Patterns of Glyma03g08050

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma03g08050 not represented in the dataset	Glyma03g08050 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g08050 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g059100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g08050

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g08050

Limit To All Plant Sequences

>Glyma03g08050.2   sequence type=CDS   gene model=Glyma03g08050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATGGAACAGGCCAGTGCTAGATCAGAACTTGTACAACATGGGGATGAAAATGACCTCAACAACGTTTGCATCCACCACTGTTAATGTCCTCCCGGCCATTACTTTTGTAATGGCACTCGTTTTCAGGCTAGAGAAGGTGAACTTGAGAAAATTTCACAGTGTAGCCAAGGTCATTGGAACCGTCATAACAGTTTCAGGAGCTATGGTTATGACTCTGTACAAAGGCCCTGCCTTCCAAATCATAAAGGGTGGAGGAGCCATGAGCCACCATAGCAACTCTAGCAGTACCAGTACCACCGAACCCTCTGACCAGCACTGGATAGTTGGAACTGTTTATCTCCTATTTCTTCATTTTTTTCCAATCTAG

Predicted protein sequences of Glyma03g08050

Limit To All Plant Sequences

>Glyma03g08050.2   sequence type=predicted peptide   gene model=Glyma03g08050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKWNRPVLDQNLYNMGMKMTSTTFASTTVNVLPAITFVMALVFRLEKVNLRKFHSVAKVIGTVITVSGAMVMTLYKGPAFQIIKGGGAMSHHSNSSSTSTTEPSDQHWIVGTVYLLFLHFFPI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain